DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a21 and CYP4X1

DIOPT Version :9

Sequence 1:NP_611003.2 Gene:Cyp6a21 / 36665 FlyBaseID:FBgn0033981 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_828847.1 Gene:CYP4X1 / 260293 HGNCID:20244 Length:509 Species:Homo sapiens


Alignment Length:502 Identity:120/502 - (23%)
Similarity:214/502 - (42%) Gaps:74/502 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 PCEEPHILMGSMKGVR--TARSFNEIWTSYYNKFR-GSGPFAGFYWFRRP--AVFVLETSLAKQI 94
            |....|..:|..|.::  ......||...|...|. ..|||..|:....|  |..:|..:..|..
Human    47 PAPPTHWFLGHQKFIQDDNMEKLEEIIEKYPRAFPFWIGPFQAFFCIYDPDYAKTLLSRTDPKSQ 111

  Fly    95 LIKEFNKFTDRGFFHNPEDDPLSGQ-LFLLDGQKWRTMRNKLSSTFTSGKMKYMFPTVVKVANEF 158
            .:::|:             .||.|: |..|||.||...|..|:..|....:|.....:.......
Human   112 YLQKFS-------------PPLLGKGLAALDGPKWFQHRRLLTPGFHFNILKAYIEVMAHSVKMM 163

  Fly   159 TDVFGQNVA-KSPVVEVRELLARFTTDVIGTCAFGIE--C--SSLKDPDAE---------FREMG 209
            .|.:.:..: :...|||.|.:...:.|:|..|||..|  |  :|..||.|:         |..: 
Human   164 LDKWEKICSTQDTSVEVYEHINSMSLDIIMKCAFSKETNCQTNSTHDPYAKAIFELSKIIFHRL- 227

  Fly   210 RRSLTEQ-----RLGPVGIGFVNSFPNLARRLHMKMTAEPIERFFMRIVRE-----TVAFREQNN 264
             .||...     :|.|.|.    .|..|:|.|:         ::...|::|     ....::.|.
Human   228 -YSLLYHSDIIFKLSPQGY----RFQKLSRVLN---------QYTDTIIQERKKSLQAGVKQDNT 278

  Fly   265 IRR--NDFMDQLIDLKNKPLMVSQSGESVNLTIEEIAAQAFVFFAAGFETSSTTMGFALYELAQN 327
            .:|  .||:|.::..|:      :||.|  .:..::.::...|..||.:|.:.::.:.||.||.|
Human   279 PKRKYQDFLDIVLSAKD------ESGSS--FSDIDVHSEVSTFLLAGHDTLAASISWILYCLALN 335

  Fly   328 QDIQNRVRKECQEVIEKCNGELNYESMKDLVYLDQVVSETLRLYTVLPVLNRECLEDYEVPGHPK 392
            .:.|.|.|:|.:.::.. ...:.::.:.::.|....:.||.||...:|.::|:..:....|  ..
Human   336 PEHQERCREEVRGILGD-GSSITWDQLGEMSYTTMCIKETCRLIPAVPSISRDLSKPLTFP--DG 397

  Fly   393 YVIKKGMPVLIPCGAMHRDEKLYANPNTFNPDNFSPERVKERDSVEWLPFGDGPRNCIGMRFGQM 457
            ..:..|:.|::....:|.:..::.||..|:|..||.|...:|....:|||..|.|||||..|..:
Human   398 CTLPAGITVVLSIWGLHHNPAVWKNPKVFDPLRFSQENSDQRHPYAYLPFSAGSRNCIGQEFAMI 462

  Fly   458 QARIGLALLIKDFKFSVCEKTTIPMTYNKEMFLIASNSGIYLKAERV 504
            :.::.:||::..|:  |....|.|:|:... |::...:|:||..:::
Human   463 ELKVTIALILLHFR--VTPDPTRPLTFPNH-FILKPKNGMYLHLKKL 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a21NP_611003.2 p450 35..499 CDD:278495 118/495 (24%)
CYP4X1NP_828847.1 p450 47..501 CDD:306555 118/495 (24%)
heme binding region 447..460 7/12 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.