DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a21 and Cyp4b1

DIOPT Version :9

Sequence 1:NP_611003.2 Gene:Cyp6a21 / 36665 FlyBaseID:FBgn0033981 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_058695.2 Gene:Cyp4b1 / 24307 RGDID:2480 Length:511 Species:Rattus norvegicus


Alignment Length:532 Identity:120/532 - (22%)
Similarity:217/532 - (40%) Gaps:90/532 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLLTALLALVGYLLMKWRSTMRHWQDLGIPCEEPHILMGSMKGVRTARSFNEIWTSYYNKFRGSG 70
            :|:..:|.|...||.  |..:....| ..|....|.|.|....::...|.::: .|:..:|    
  Rat    21 ILMVIVLKLFSLLLR--RQKLARAMD-SFPGPPTHWLFGHALEIQKLGSLDKV-VSWAQQF---- 77

  Fly    71 PFAGFYWFRRPAVF--VLETSLAKQILIKEFNKFTDRGFFHNPEDDPLSGQ------------LF 121
            |.|...||.:...|  :.|...||.:.        .||       ||.:..            |.
  Rat    78 PHAHPLWFGQFVGFLNIYEPDYAKAVY--------SRG-------DPKAADVYDFFLQWIGKGLL 127

  Fly   122 LLDGQKWRTMRNKLSSTFTSGKMKYMFPTVVKVANEFTDVFGQNVAKSPVVEVRELLARFTTDVI 186
            :|||.||...|..|:..|....:|.......:......|.:.:..:::...::...:.....|.:
  Rat   128 VLDGPKWFQHRKLLTPGFHYDVLKPYVAIFAESTRMMLDKWEKKASENKSFDIFCDVGHMALDTL 192

  Fly   187 GTCAFGIECSSLKDPDAEFREMGRRSLT---EQRLGPVGIGFVNSFPNLARRLHMKMT--AEPIE 246
            ..|.||...|.|...|..: .:....||   :||        ::||     :.|....  ..|..
  Rat   193 MKCTFGKGDSGLGHRDNSY-YLAVSDLTLLMQQR--------IDSF-----QYHNDFIYWLTPHG 243

  Fly   247 RFFMR-----------IVRETVAF----REQNNI---RRNDFMDQLIDLKNKPLMVSQSGESVNL 293
            |.|:|           ::|:..|.    :|:..|   |..||:|.|:.:::      :||  :.|
  Rat   244 RRFLRACKIAHDHTDEVIRQRKAALQDEKERKKIQQRRHLDFLDILLGVRD------ESG--IKL 300

  Fly   294 TIEEIAAQAFVFFAAGFETSSTTMGFALYELAQNQDIQNRVRKECQEVIEKCNGELNYESMKDLV 358
            :..|:.|:...|...|.:|:::.:.:.||.:|...:.|...|:|.:.::.. .....::.:..:.
  Rat   301 SDAELRAEVDTFMFEGHDTTTSGISWFLYCMALYPEHQQLCREEVRGILGD-QDSFQWDDLAKMT 364

  Fly   359 YLDQVVSETLRLYTVLPVLNRECLEDYE-VPGHPKYVIKKGMPVLIPCGAMHRDEKLYANPNTFN 422
            ||...:.|..|||..:|.:.|:..:... |.|..   :..|..:.:...|:||:..::.:|..|:
  Rat   365 YLTMCMKECFRLYPPVPQVYRQLNKPVTFVDGRS---LPAGSLISLHIYALHRNSTVWPDPEVFD 426

  Fly   423 PDNFSPERVKERDSVEWLPFGDGPRNCIGMRFGQMQARIGLALLIKDFKFSVCEKTTIPMTYNKE 487
            |..||||....|....::||..|||||||.:|...:.::..||.:..|:||: :.:.:|:  ...
  Rat   427 PLRFSPENAAGRHPFAFMPFSAGPRNCIGQQFAMNEMKVVTALCLLRFEFSL-DPSKMPI--KVP 488

  Fly   488 MFLIASNSGIYL 499
            ..::.|.:||:|
  Rat   489 QLILRSKNGIHL 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a21NP_611003.2 p450 35..499 CDD:278495 112/501 (22%)
Cyp4b1NP_058695.2 p450 47..500 CDD:278495 112/501 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.