DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a21 and CYP4Z1

DIOPT Version :9

Sequence 1:NP_611003.2 Gene:Cyp6a21 / 36665 FlyBaseID:FBgn0033981 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_835235.1 Gene:CYP4Z1 / 199974 HGNCID:20583 Length:505 Species:Homo sapiens


Alignment Length:533 Identity:122/533 - (22%)
Similarity:221/533 - (41%) Gaps:84/533 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TVLLTALLALVGYLLMKWRSTMRHWQDLGIPCEEPHILMGSMKGVRTARSFNEIWTSYYNKFRGS 69
            ::||..::.|  |...:|.....|.    .|....|...|. |.....:.| |::.....|:..:
Human    23 SLLLFQVIRL--YQRRRWMIRALHL----FPAPPAHWFYGH-KEFYPVKEF-EVYHKLMEKYPCA 79

  Fly    70 -----GPFAGFYWFRRP--AVFVLETSLAKQ-ILIKEFNKFTDRGFFHNPEDDPLSGQLFLLDGQ 126
                 |||..|:....|  |..:|:....|. :..|....:..||             |..|||.
Human    80 VPLWVGPFTMFFSVHDPDYAKILLKRQDPKSAVSHKILESWVGRG-------------LVTLDGS 131

  Fly   127 KWRTMRNKLSSTFTSGKMKYMFPTVVKVANEFTDVFGQNVAKSPVVEVRELLARFTTDVIGTCAF 191
            ||:..|..:...|....:|.....:.:......:.:.:::|::..:|:.:.::..|.|.|..|||
Human   132 KWKKHRQIVKPGFNISILKIFITMMSESVRMMLNKWEEHIAQNSRLELFQHVSLMTLDSIMKCAF 196

  Fly   192 GIECSSLKDP--DAEFREMGRRS-LTEQRLGPVGIGFVNSFPNLARRLH-----MKMTAEPIERF 248
            ..:.|...|.  |:..:.:...| ::.||:        |:|      ||     .|.:::  .:.
Human   197 SHQGSIQLDSTLDSYLKAVFNLSKISNQRM--------NNF------LHHNDLVFKFSSQ--GQI 245

  Fly   249 FMRIVRETVAFREQ-----------------NNIRRNDFMDQLIDLKNKPLMVSQSGESVNLTIE 296
            |.:..:|...|.|:                 ...||.||:|.|:..|        |..:.:.:..
Human   246 FSKFNQELHQFTEKVIQDRKESLKDKLKQDTTQKRRWDFLDILLSAK--------SENTKDFSEA 302

  Fly   297 EIAAQAFVFFAAGFETSSTTMGFALYELAQNQDIQNRVRKECQEVIEKCNGELNYESMKDLVYLD 361
            ::.|:...|..||.:|:|:.:.:.||.||:..:.|.|.|.|.:|::.. ...:.:|.:..:.|..
Human   303 DLQAEVKTFMFAGHDTTSSAISWILYCLAKYPEHQQRCRDEIRELLGD-GSSITWEHLSQMPYTT 366

  Fly   362 QVVSETLRLYTVLPVLNRECLEDYEVPGHPKYVIKKGMPVLIPCGAMHRDEKLYANPNTFNPDNF 426
            ..:.|.||||.  ||:|...|.|..:.......:..|:.|.|...|:|.:...:.:|..|||..|
Human   367 MCIKECLRLYA--PVVNISRLLDKPITFPDGRSLPAGITVFINIWALHHNPYFWEDPQVFNPLRF 429

  Fly   427 SPERVKERDSVEWLPFGDGPRNCIGMRFGQMQARIGLALLIKDFKFSVCEKTTIPMTYNKEMFLI 491
            |.|..::.....::||..|.|||||..|..::.::.:||.:..||.:. :.:..|....:  .::
Human   430 SRENSEKIHPYAFIPFSAGLRNCIGQHFAIIECKVAVALTLLRFKLAP-DHSRPPQPVRQ--VVL 491

  Fly   492 ASNSGIYLKAERV 504
            .|.:||::.|::|
Human   492 KSKNGIHVFAKKV 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a21NP_611003.2 p450 35..499 CDD:278495 114/496 (23%)
CYP4Z1NP_835235.1 p450 47..500 CDD:278495 114/497 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.