DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a21 and cest-32

DIOPT Version :9

Sequence 1:NP_611003.2 Gene:Cyp6a21 / 36665 FlyBaseID:FBgn0033981 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_504397.1 Gene:cest-32 / 178909 WormBaseID:WBGene00016862 Length:545 Species:Caenorhabditis elegans


Alignment Length:514 Identity:95/514 - (18%)
Similarity:161/514 - (31%) Gaps:168/514 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 LGIP-CEEPHILMGSMKGVRTARSFNEIWTSYYN--KFRGSGPFAGFYWFRRPAVFVLETSLAKQ 93
            |||| .:.|...:...|.|..     |.||...|  |:....|.:|              .:...
 Worm    40 LGIPFAKAPICELRFKKPVEA-----EKWTKPLNCHKYGPGCPQSG--------------HMISN 85

  Fly    94 ILIKEFNKFTDRGFFHNPEDDPLSGQLFLLDGQKWRTMRNKLSSTFTSGK--MKYMFPTVVKVAN 156
            :|...:.:|.        ||:.|:..:|   ...|:      |..|.:|.  |.|......::. 
 Worm    86 LLPPGYREFA--------EDNCLNLNIF---APSWK------SEEFPNGLPIMVYFHGGGFEIG- 132

  Fly   157 EFTDVFGQNVAKS--PVVEVRELLARFTTDVIGTCAFGIECS-----------SLKDPDAEFREM 208
             |:.:|.......  |:.:|..:.|.:....:|....|.|.|           :||......:..
 Worm   133 -FSSMFDDYSLSGTLPLKDVIVVTANYRVGPLGFMTTGDEVSRGNYGLWDQTLALKWVQEHIKSF 196

  Fly   209 GRR----SLTEQRLGPVGIGFVNSFPNLARRLH--MKMTAEPIERFFMRIVRETVA-----FREQ 262
            |..    ::.....|.|..|.:...|:..:..|  |.|:......|.:| .:|..|     |.:.
 Worm   197 GGNPNIVTVCGTSAGGVSAGLLALSPHSNKLFHRFMAMSGSAFCEFSIR-TKEQEAEIFRNFAKH 260

  Fly   263 NNIRRNDFMDQLIDLKNKPLMVSQSGESVNLTIEEIAAQAFVFFAAGF----------------- 310
            :.....|....|...|::||...|.    ..|.|: .|..|:.|...|                 
 Worm   261 HGYEGEDSESLLEWYKSQPLSKFQE----TATFEK-KASGFLTFIPNFDGDFFPKPFDELSREAP 320

  Fly   311 --ETSSTT-----MGF-ALYELAQNQ-----------------DIQNRVR--------KECQEVI 342
              :..:|.     :|| .:::..:|.                 |:|.|:.        |...:.:
 Worm   321 KLDAMATVDEYEGLGFLTMFQSRRNDMDIIKSSFGSDVVENAVDVQKRIMEFYMKNIDKNDDKAV 385

  Fly   343 EKCNGELNYESMKDLVYLDQVVSET----------LRLY---------TVLPVLNRECLEDYEVP 388
            ||...:|..:|..::..|:.|.:.|          ...|         |..|         ::..
 Worm   386 EKRLIQLISDSWFNIGALETVKTSTKYGSNAYLGSFDYYNMGSNDPYATWFP---------FKAA 441

  Fly   389 GHP---KYVIKKGMPVLIP----------CGAMHRDEKLYANPNTFN-PD---NFSPER 430
            .|.   ||::.:||....|          .|.:..:...|.|||..| |:   .::||:
 Worm   442 NHGSELKYMLGEGMGKFSPIEEEFKVIDMMGTLTANFVKYGNPNGINGPELWKKYTPEK 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a21NP_611003.2 p450 35..499 CDD:278495 92/511 (18%)
cest-32NP_504397.1 COesterase 15..516 CDD:278561 95/514 (18%)
Aes <104..>227 CDD:223730 23/133 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.