DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a21 and CYP4A11

DIOPT Version :9

Sequence 1:NP_611003.2 Gene:Cyp6a21 / 36665 FlyBaseID:FBgn0033981 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_000769.2 Gene:CYP4A11 / 1579 HGNCID:2642 Length:519 Species:Homo sapiens


Alignment Length:525 Identity:127/525 - (24%)
Similarity:224/525 - (42%) Gaps:53/525 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VGTVLLTALLALVGYLLMKWRSTMRHWQDL-----GIPCEEPHILMGSMKGVRTARSFNEIWTSY 62
            |..:|..|.|.::..||:|......|.|.|     ..||...|.|.|.::.::..:....| ..:
Human    15 VSGILQAASLLILLLLLIKAVQLYLHRQWLLKALQQFPCPPSHWLFGHIQELQQDQELQRI-QKW 78

  Fly    63 YNKFRGSGPFAGFYWFRRPAVFVLETSLAKQILIKEFNKFTDRGFFHNPEDDPLSGQLFLLDGQK 127
            ...|..:.|.  :.|..:..|.:.:....|.||.:...|......|..|.   :...|.||:||.
Human    79 VETFPSACPH--WLWGGKVRVQLYDPDYMKVILGRSDPKSHGSYRFLAPW---IGYGLLLLNGQT 138

  Fly   128 WRTMRNKLSSTFTSGKMK----YMFPTVVKVANEFTDVFGQNVAKSPVVEVRELLARFTTDVIGT 188
            |...|..|:..|....:|    .|..:|..:.:::.::.||:   || :||.:.::..|.|.|..
Human   139 WFQHRRMLTPAFHYDILKPYVGLMADSVRVMLDKWEELLGQD---SP-LEVFQHVSLMTLDTIMK 199

  Fly   189 CAFGIECSSLKDPDAEFREMGRRSLTEQRLGPVGIGF-----VNSFPNLARRLHM------KMTA 242
            |||..:.|...|.:::........|.......|...|     :.|..:..|..|.      :.|.
Human   200 CAFSHQGSIQVDRNSQSYIQAISDLNNLVFSRVRNAFHQNDTIYSLTSAGRWTHRACQLAHQHTD 264

  Fly   243 EPIERFFMRIVRETVAFREQNNIRRN---DFMDQLIDLKNKPLMVSQSGESVNLTIEEIAAQAFV 304
            :.|:....::.:|    .|...|:|.   ||:|.|       |:......|: |:.:::.|:...
Human   265 QVIQLRKAQLQKE----GELEKIKRKRHLDFLDIL-------LLAKMENGSI-LSDKDLRAEVDT 317

  Fly   305 FFAAGFETSSTTMGFALYELAQNQDIQNRVRKECQEVIEKCNGELNYESMKDLVYLDQVVSETLR 369
            |...|.:|:::.:.:.||.||.:...|.|.|:|...::.. ...:.:..:..:.|....:.|.||
Human   318 FMFEGHDTTASGISWILYALATHPKHQERCREEIHSLLGD-GASITWNHLDQMPYTTMCIKEALR 381

  Fly   370 LYTVLPVLNRECLEDYEVPGHPKYVIKKGMPVLIPCGAMHRDEKLYANPNTFNPDNFSPERVKER 434
            ||..:|.:.||.......|....  :.||:.||:....:|.:.|::.||..|:|..|:|...:. 
Human   382 LYPPVPGIGRELSTPVTFPDGRS--LPKGIMVLLSIYGLHHNPKVWPNPEVFDPFRFAPGSAQH- 443

  Fly   435 DSVEWLPFGDGPRNCIGMRFGQMQARIGLALLIKDFKFSVCEKTTIPMTYNKEMFLIASNSGIYL 499
             |..:|||..|.|||||.:|...:.::..||.:..|:. :.:.|.||:...:  .::.|.:||:|
Human   444 -SHAFLPFSGGSRNCIGKQFAMNELKVATALTLLRFEL-LPDPTRIPIPIAR--LVLKSKNGIHL 504

  Fly   500 KAERV 504
            :..|:
Human   505 RLRRL 509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a21NP_611003.2 p450 35..499 CDD:278495 115/481 (24%)
CYP4A11NP_000769.2 p450 52..505 CDD:278495 115/482 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.