DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a21 and CYP3A4

DIOPT Version :9

Sequence 1:NP_611003.2 Gene:Cyp6a21 / 36665 FlyBaseID:FBgn0033981 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_059488.2 Gene:CYP3A4 / 1576 HGNCID:2637 Length:503 Species:Homo sapiens


Alignment Length:505 Identity:152/505 - (30%)
Similarity:259/505 - (51%) Gaps:71/505 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 TALLALVGYLLMKWRSTMRH--WQDLGIPCEEPHILMGSM----KG-----VRTARSFNEIWTSY 62
            |.||..|..:|:....|..|  ::.||||...|...:|::    ||     :...:.:.::|   
Human    11 TWLLLAVSLVLLYLYGTHSHGLFKKLGIPGPTPLPFLGNILSYHKGFCMFDMECHKKYGKVW--- 72

  Fly    63 YNKFRGSGPFAGFYWFRRPAVFVLETSLAKQILIKE-FNKFTDR------GFFHNPEDDPLSGQL 120
                       |||..::|.:.:.:..:.|.:|:|| ::.||:|      ||        :...:
Human    73 -----------GFYDGQQPVLAITDPDMIKTVLVKECYSVFTNRRPFGPVGF--------MKSAI 118

  Fly   121 FLLDGQKWRTMRNKLSSTFTSGKMKYMFPTVVKVANEFTDVFGQNVAK-----SPVVEVRELLAR 180
            .:.:.::|:.:|:.||.||||||:|.|.|.:.    ::.||..:|:.:     .||. ::::...
Human   119 SIAEDEEWKRLRSLLSPTFTSGKLKEMVPIIA----QYGDVLVRNLRREAETGKPVT-LKDVFGA 178

  Fly   181 FTTDVIGTCAFGIECSSLKDPDAEFREMGRRSLTEQRLGPVGIGFVNSFPNL---ARRLHMKMTA 242
            ::.|||.:.:||:...||.:|...|.|..::.|....|.|..:. :..||.|   ...|::.:..
Human   179 YSMDVITSTSFGVNIDSLNNPQDPFVENTKKLLRFDFLDPFFLS-ITVFPFLIPILEVLNICVFP 242

  Fly   243 EPIERFFMRIVRETVAFR-EQNNIRRNDFMDQLIDLKNKPLMVSQSGESVN-LTIEEIAAQAFVF 305
            ..:..|..:.|:.....| |.....|.||:..:||.:|     |:..||.. |:..|:.||:.:|
Human   243 REVTNFLRKSVKRMKESRLEDTQKHRVDFLQLMIDSQN-----SKETESHKALSDLELVAQSIIF 302

  Fly   306 FAAGFETSSTTMGFALYELAQNQDIQNRVRKECQEVIEKCNGELNYESMKDLVYLDQVVSETLRL 370
            ..||:||:|:.:.|.:||||.:.|:|.::::|...|:.. .....|:::..:.|||.||:|||||
Human   303 IFAGYETTSSVLSFIMYELATHPDVQQKLQEEIDAVLPN-KAPPTYDTVLQMEYLDMVVNETLRL 366

  Fly   371 YTVLPVLNRECLEDYEVPGHPKYVIKKGMPVLIPCGAMHRDEKLYANPNTFNPDNFSPERVKERD 435
            :.:...|.|.|.:|.|:.|   ..|.||:.|:||..|:|||.|.:..|..|.|:.||.   |.:|
Human   367 FPIAMRLERVCKKDVEING---MFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFSK---KNKD 425

  Fly   436 SVE---WLPFGDGPRNCIGMRFGQMQARIGLALLIKDFKFSVCEKTTIPM 482
            :::   :.|||.||||||||||..|..::.|..::::|.|..|::|.||:
Human   426 NIDPYIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPL 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a21NP_611003.2 p450 35..499 CDD:278495 142/477 (30%)
CYP3A4NP_059488.2 p450 39..493 CDD:365848 142/477 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 1 1.000 - - FOG0000037
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X40
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.