DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a21 and Cyp3a13

DIOPT Version :9

Sequence 1:NP_611003.2 Gene:Cyp6a21 / 36665 FlyBaseID:FBgn0033981 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_031845.1 Gene:Cyp3a13 / 13113 MGIID:88610 Length:503 Species:Mus musculus


Alignment Length:520 Identity:156/520 - (30%)
Similarity:259/520 - (49%) Gaps:67/520 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSVGTVLLTALLALVGYLLMKWRSTMRH--WQDLGIPCEEPHILMGSM----KG-----VRTARS 54
            |....:|.|:|:.|..|      .|..|  ::.||||..:|...:|::    ||     ::..:.
Mouse     9 METWMLLATSLVLLYLY------GTHSHGIFKKLGIPGPKPLPFLGTILAYQKGFWECDIQCHKK 67

  Fly    55 FNEIWTSYYNKFRGSGPFAGFYWFRRPAVFVLETSLAKQILIKE-FNKFTDRGFFHNPEDDP--- 115
            :.::|              |.|..|:|.:.:.:..:.|.:|:|| ::.||:|..|     .|   
Mouse    68 YGKMW--------------GLYDGRQPVLAITDPDIIKTVLVKECYSTFTNRRRF-----GPVGI 113

  Fly   116 LSGQLFLLDGQKWRTMRNKLSSTFTSGKMKYMFPTVVKVANEFTDVFGQN----VAKSPVVEVRE 176
            |...:.:.:.::|:.:|..||.|||||::|.|||    :.|:||||..:|    :.:.....:::
Mouse   114 LKKAISISENEEWKRIRALLSPTFTSGRLKEMFP----IINQFTDVLVRNMRQGLGEGKPTSMKD 174

  Fly   177 LLARFTTDVIGTCAFGIECSSLKDPDAEFREMGRRSLTEQRLGPVGIGFVNSFPNLA---RRLHM 238
            :...::.|||...:||:...||.:|...|.|..::.|......|:.:. |..||.|.   ..|::
Mouse   175 IFGAYSMDVITATSFGVNIDSLNNPQDPFVEKIKKLLKFDIFDPLFLS-VTLFPFLTPVFDALNV 238

  Fly   239 KMTAEPIERFFMRIVRETVAFR-EQNNIRRNDFMDQLIDLKNKPLMVSQSGESVNLTIEEIAAQA 302
            .:....:..||...|......| ::...:|.||:..:|:.:|.....|...    |:..||.||:
Mouse   239 SLFPRDVISFFTTSVERMKENRMKEKEKQRVDFLQLMINSQNYKTKESHKA----LSDVEIVAQS 299

  Fly   303 FVFFAAGFETSSTTMGFALYELAQNQDIQNRVRKECQEVIEKCNGELNYESMKDLVYLDQVVSET 367
            .:|..||:||:|:.:.||||.||.:.|:|.:::.|....:.. .....|:::..:.|||.||:||
Mouse   300 VIFIFAGYETTSSALSFALYLLAIHPDVQKKLQDEIDAALPN-KAPATYDTLLQMEYLDMVVNET 363

  Fly   368 LRLYTVLPVLNRECLEDYEVPGHPKYVIKKGMPVLIPCGAMHRDEKLYANPNTFNPDNFSPERVK 432
            ||||.:...|.|.|..|.|:.|   ..|.||..|:||..|:|:|.|.:..|..|.|:.||.   |
Mouse   364 LRLYPIAGRLERVCKTDVEING---LFIPKGTVVMIPTFALHKDPKYWPEPEEFRPERFSK---K 422

  Fly   433 ERDSVE---WLPFGDGPRNCIGMRFGQMQARIGLALLIKDFKFSVCEKTTIPMTYNKEMFLIASN 494
            .:||:.   :||||.||||||||||..:..::.|..::::|....|::|.||:..:|:..|...|
Mouse   423 NQDSINPYMYLPFGSGPRNCIGMRFALINMKVALVRVLQNFTVQPCKETEIPLKLSKQGLLQPEN 487

  Fly   495  494
            Mouse   488  487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a21NP_611003.2 p450 35..499 CDD:278495 145/484 (30%)
Cyp3a13NP_031845.1 p450 39..491 CDD:365848 145/484 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0158
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000037
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X40
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.710

Return to query results.
Submit another query.