DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a21 and Cyp4f15

DIOPT Version :9

Sequence 1:NP_611003.2 Gene:Cyp6a21 / 36665 FlyBaseID:FBgn0033981 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_598888.1 Gene:Cyp4f15 / 106648 MGIID:2146921 Length:534 Species:Mus musculus


Alignment Length:518 Identity:126/518 - (24%)
Similarity:226/518 - (43%) Gaps:85/518 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 KWRSTMRHWQDLGIPCEEPHILMGSMKGVRTARSFNEIWTSYYNKFRGSGPFAGFYWFRRPAVF- 84
            ||...:.|   ||:.....|.|......|.|.......|.         ||.........|.:. 
Mouse    61 KWNWFLGH---LGMITPTEHGLKEVTNLVATYPQGFMTWL---------GPIIPIITLCHPDIIR 113

  Fly    85 -VLETSLA---KQILIKEFNKFTDRGFFHNPEDDPLSGQ-LFLLDGQKWRTMRNKLSSTFTSGKM 144
             ||..|.:   |:::...|.|             |..|. |.|.||.||.:.|..|:..|....:
Mouse   114 SVLNASASVALKEVVFYSFLK-------------PWLGDGLLLSDGDKWSSHRRMLTPAFHFNIL 165

  Fly   145 KYMFPTVVKVANEFTDVF---GQNVAK--SPVVEVRELLARFTTDVIGTCAFGIECSSLKDPD-- 202
            |    ..||:.|:.|::.   .|::|.  |..::|.|.::..|.|.:..|.|..:.:..::|.  
Mouse   166 K----PYVKIFNDSTNIMHAKWQHLASGGSARLDVFENISLMTLDSLQKCVFSFDSNCQENPSEY 226

  Fly   203 -AEFREMGRRSLTEQRLGPVGIGFVNSFPNL---ARRLHMKMTAEPIERFFMRIV---RETVAFR 260
             :...|:.  :|..:|...: :..::|...|   .||.|  .....:..|...::   |.|:..:
Mouse   227 ISAILELS--ALVTKRYHQL-LLHIDSLYQLTCSGRRFH--KACHLVHSFTDAVIQDRRRTLPSK 286

  Fly   261 EQNNI-------RRNDFMDQLIDLKNKPLMVSQSGESVNLTIEEIAAQAFVFFAAGFETSSTTMG 318
            .::::       :..||:|        .|::|:..:...|:.|:|.|:|..|...|.:|:::.:.
Mouse   287 HEDDVLKAKAKSKTLDFID--------VLLLSKDEDGKELSDEDIRAEADTFMFEGHDTTASGLS 343

  Fly   319 FALYELAQNQDIQNRVRKECQEVIE-------KCN-GELNYESMKDLVYLDQVVSETLRLYTVLP 375
            :.||.||::.:.|.|.|:|.||::.       :|: .....:.:..|.:|...:.|:|||:..:.
Mouse   344 WILYNLARHPEYQERCRQEVQELLRDRESTEIECSCAVFLRDDLAQLPFLTMCIKESLRLHPPVT 408

  Fly   376 VLNRECLEDYEVP-GHPKYVIKKGMPVLIPCGAMHRDEKLYANPNTFNPDNFSPERVKERDSVEW 439
            |::|.|.:|..:| |.   ||.||:..:|...|.|.:..::.:|..::|..|.||.:|:|..:.:
Mouse   409 VISRRCTQDIVLPDGR---VIPKGVICIINIFATHHNPTVWPDPEVYDPFRFDPENIKDRSPLAF 470

  Fly   440 LPFGDGPRNCIGMRFGQMQARIGLALLIKDFKFSVCEKTTIPMTYNKEMFLIASNSGIYLKAE 502
            :||..|||||||..|...:.::.|||.:  .:|.|......|.  .|...::.:..|::|:.|
Mouse   471 IPFSAGPRNCIGQTFAMNEMKVALALTL--LRFRVLPDDKEPR--RKPELILRAEGGLWLRVE 529

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a21NP_611003.2 p450 35..499 CDD:278495 119/499 (24%)
Cyp4f15NP_598888.1 p450 57..526 CDD:278495 124/513 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.