DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a21 and Cyp4a32

DIOPT Version :9

Sequence 1:NP_611003.2 Gene:Cyp6a21 / 36665 FlyBaseID:FBgn0033981 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_001093651.1 Gene:Cyp4a32 / 100040843 MGIID:3717148 Length:509 Species:Mus musculus


Alignment Length:557 Identity:121/557 - (21%)
Similarity:219/557 - (39%) Gaps:125/557 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SVGTVLLTALLALVGYLLMKWRSTMRHWQDLGIPCEEPHILMGSMKGVRTARSFNEIWTSYYNKF 66
            ||..:||..:.|:..||..||                      .:|.::...|....|...:.:|
Mouse    23 SVLGLLLLLVKAVQFYLHRKW----------------------LLKALQQFPSPPFHWFFGHEQF 65

  Fly    67 RGS--------------GPFAGFYWFRRPAVFVLETSLAKQILIKEFNKFTDRGFFHNPEDDPLS 117
            :|.              ..|..::|.....:.|.:....|.||               ...||.:
Mouse    66 KGEQELKEVVSCIEHFPSAFPCWFWGSNAYLTVYDPDYMKVIL---------------GRSDPKA 115

  Fly   118 GQLF------------LLDGQKWRTMRNKLSSTFTSGKMKYMFPTVVKVANE---FTDVFGQNVA 167
            ..::            ||:||.|...|..|:..|....:|   |.|..:|:.   ..|.:.:...
Mouse   116 NGIYRLLAPWIGYGLLLLNGQPWFQHRRMLTPAFHYDILK---PYVKNMADSIRLMLDKWERLAG 177

  Fly   168 KSPVVEVRELLARFTTDVIGTCAFGIECSSLKDPDAEFREMGRRSLTEQRLGPVGIGFVNSFPNL 232
            :...:|:.:.::..|.|.:..|||..:.|...|        |......|.:|.:.    |.|.:.
Mouse   178 QDSSIEIFQHISLMTLDTVMKCAFSHKGSVQVD--------GNYKTYLQAIGDLN----NLFHSR 230

  Fly   233 ARRL-HMKMTAEPIERFFM--RIVRE-----------TVAFR--------EQNNI---RRNDFMD 272
            .|.: |...|   |.|...  |:.::           .:..|        |..||   ||.||:|
Mouse   231 VRNIFHQNDT---IYRLSSNGRLAKQACQLAHDHTDGVIKMRKDQLQDEGELENIKKKRRLDFLD 292

  Fly   273 QLIDLKNKPLMVSQSGESVNLTIEEIAAQAFVFFAAGFETSSTTMGFALYELAQNQDIQNRVRKE 337
            .|:..:      .::|:|  ::.:::.|:...|...|.:|:::.:.:..|.||.:.:.|.|.|:|
Mouse   293 ILLFAR------MENGDS--MSDKDLRAEVDTFMFEGHDTTASGVSWIFYALATHPEHQQRCREE 349

  Fly   338 CQEVIEKCNGELNYESMKDLVYLDQVVSETLRLYTVLPVLNRECLEDYEVPGHPKYVIKKGMPVL 402
            .|.::.. ...:.::.:..:.|....:.|.||||..:|.:.||.......|....  :.||:.|.
Mouse   350 VQSLLGD-GSSITWDHLDQIPYTTMCIKEALRLYPPVPGIVRELSTSVTFPDGRS--LPKGVQVT 411

  Fly   403 IPCGAMHRDEKLYANPNTFNPDNFSPERVKERDSVEWLPFGDGPRNCIGMRFGQMQARIGLALLI 467
            :....:|.:.|::.||..|:|..|:|:  ..|.|..:|||..|.|||||.:|...:.::.:||.:
Mouse   412 LSIYGLHHNPKVWPNPEVFDPSRFAPD--SPRHSHSFLPFSGGARNCIGKQFAMSELKVIVALTL 474

  Fly   468 KDFKFSVCEKTTIPMTYNKEMFLIASNSGIYLKAERV 504
            ..|:. :.:.|.:|....:  .::.|.:||||..:::
Mouse   475 LHFEL-LPDPTRVPEPLAR--IVLKSKNGIYLHLKKL 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a21NP_611003.2 p450 35..499 CDD:278495 110/517 (21%)
Cyp4a32NP_001093651.1 p450 52..503 CDD:278495 109/499 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.