DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a20 and CYP97A3

DIOPT Version :9

Sequence 1:NP_611002.3 Gene:Cyp6a20 / 36664 FlyBaseID:FBgn0033980 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_564384.1 Gene:CYP97A3 / 840067 AraportID:AT1G31800 Length:595 Species:Arabidopsis thaliana


Alignment Length:500 Identity:116/500 - (23%)
Similarity:216/500 - (43%) Gaps:65/500 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 GIPHDEPKIP--YGNTSELMKTVHFADIFK--RTYNKLRNKTDGPFVGFYMYFKRMVVVTDIDFA 90
            |...|.||:|  .|:...:.....|..:::  .||..:...|.||        |..::|:|...|
plant   105 GSDQDYPKVPEAKGSIQAVRNEAFFIPLYELFLTYGGIFRLTFGP--------KSFLIVSDPSIA 161

  Fly    91 KTVLIREFDKFHDRGVFHNERDDPLSANLVNIDGQKWKTLRQKLTPTFTSGKMKTMFPTILTVGD 155
            |.:| ::..|.:.:|:.....|..:...|:..||:.|:..|:.:.|......:..|........|
plant   162 KHIL-KDNAKAYSKGILAEILDFVMGKGLIPADGEIWRRRRRAIVPALHQKYVAAMISLFGEASD 225

  Fly   156 ELIRVFGETASADSDSMEITNVVARFTADVIGSCAFGLDCHSLSDPKAKFVQMGTTAITERRHGK 220
            .|.:.. :.|:...:.:|:.::.:|.|.|:||...|..|..||::... .::...|.:.|.....
plant   226 RLCQKL-DAAALKGEEVEMESLFSRLTLDIIGKAVFNYDFDSLTNDTG-VIEAVYTVLREAEDRS 288

  Fly   221 SMDLLLFGAP---ELAAKLRMKATVQEVEDFYMNIIRDTVDYRVKNNVKRHDFVDMLIEMKLKFD 282
            ...:.::..|   :::.:.|..||       .:.:|.||:|..:. ..||     |:.|.:|:|.
plant   289 VSPIPVWDIPIWKDISPRQRKVAT-------SLKLINDTLDDLIA-TCKR-----MVEEEELQFH 340

  Fly   283 -----------------NGDKENGLTFNEIAAQAFIFFLAGFETSSTTMGFALYELACHQDIQDK 330
                             :||   .::..::........:||.|||:..:.:..|.|.....:..|
plant   341 EEYMNERDPSILHFLLASGD---DVSSKQLRDDLMTMLIAGHETSAAVLTWTFYLLTTEPSVVAK 402

  Fly   331 LRTEINTVLKQHNGKLDYDSMREMTYLEKVIDETMRKRPVVGHLIRVATQHYQHTNPKYNIEKGT 395
            |:.|:::|:......:  ..|:::.|..:|::|::|..|....|||.:..:  ....:|.|::|.
plant   403 LQEEVDSVIGDRFPTI--QDMKKLKYTTRVMNESLRLYPQPPVLIRRSIDN--DILGEYPIKRGE 463

  Fly   396 GVIVPTLAIHHDPEFYPEPEKFIPERFDED-----QVQQRPACTFLPFGDGPRNCIGLRFGRMQV 455
            .:.:....:|..|..:.:.|||.|||:..|     :..|.  .::||||.|||.|||..|...:.
plant   464 DIFISVWNLHRSPLHWDDAEKFNPERWPLDGPNPNETNQN--FSYLPFGGGPRKCIGDMFASFEN 526

  Fly   456 IVGMALLIHNFKFEFHPTKTVVPLEYRTDDFLLSSKGGIHLKVTR 500
            :|.:|:||..|.|:..|....|.:   |....:.:..|:.|.||:
plant   527 VVAIAMLIRRFNFQIAPGAPPVKM---TTGATIHTTEGLKLTVTK 568

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a20NP_611002.3 p450 32..496 CDD:278495 112/492 (23%)
CYP97A3NP_564384.1 PLN02738 1..595 CDD:215393 116/499 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3438
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.