DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a20 and CYP88A3

DIOPT Version :10

Sequence 1:NP_611002.3 Gene:Cyp6a20 / 36664 FlyBaseID:FBgn0033980 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_172008.1 Gene:CYP88A3 / 839311 AraportID:AT1G05160 Length:490 Species:Arabidopsis thaliana


Alignment Length:56 Identity:15/56 - (26%)
Similarity:17/56 - (30%) Gaps:22/56 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 FLGSDERTFSVINELFR--------------KYG--------SFFKLSLGPKTFLC 81
            ||.|...|||:....:|              .||        |..||..||....|
plant    12 FLFSYLSTFSLAMVPYRGCDVIGVDLGDGSGNYGKGVSKGFLSGRKLVSGPSRSSC 67

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a20NP_611002.3 CYP6-like 67..495 CDD:410679 7/23 (30%)
CYP88A3NP_172008.1 PLN02302 3..490 CDD:215171 15/56 (27%)

Return to query results.
Submit another query.