DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a20 and CYP705A23

DIOPT Version :9

Sequence 1:NP_611002.3 Gene:Cyp6a20 / 36664 FlyBaseID:FBgn0033980 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_188649.1 Gene:CYP705A23 / 821557 AraportID:AT3G20140 Length:510 Species:Arabidopsis thaliana


Alignment Length:485 Identity:101/485 - (20%)
Similarity:191/485 - (39%) Gaps:86/485 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 GIPHDEPKIPYGNTSELMKTVHFADIFKRTYNKLRNKTDGPFVGFYMYFKRMVVVTDIDFAKTVL 94
            |:|.....:|......|:    |:::..::..||.:|. ||     :.:.|:..|..|..:...:
plant    41 GLPPSPLSLPIIGHLHLL----FSNLTHKSLQKLSSKY-GP-----LLYLRIFNVPIIFVSSASV 95

  Fly    95 IREFDKFHD-----RGVFHNERDDPLSANLVNID--------GQKWKTLRQKLTPTFTSGKMKTM 146
            ..|..:.||     ||      :.|:..:|:...        |..||.             ||.:
plant    96 AYEIFRGHDVNISFRG------NPPIEESLLVGSFGFFTAPYGDYWKF-------------MKKV 141

  Fly   147 FPTILTVGDELIRVFGETASA-------------DSDSMEITNVVARFTADVIGSCAFGLDCHSL 198
            ..|.|.....|.|..|..|.|             ..:|:||.....:...|.|.....|.: .|.
plant   142 MVTKLLGPQALQRSRGIRADALERFYMNLLDKAMKKESVEIGKETMKLIYDSICKMIMGRN-FSE 205

  Fly   199 SDPKAKFVQ---MGTTAITERRHGKSMDLLLFGAPELAAKLR------MKATVQEVEDFYMNII- 253
            .:.:|:.|:   ..:||:|::         :|.|..|...|:      .|..:.:|.:.:..:: 
plant   206 ENGEAERVRGLVTESTALTKK---------IFMANVLHKPLKKLGISLFKKEIMDVSNSFDELLE 261

  Fly   254 RDTVDYRVKNNVKRHDFVDMLIEMKLKFDNGDKENGLTFNEIAAQAFIFFLAGFETSSTTMGFAL 318
            |..|::..|.|..:.  :||:..:.....:.:.|..:|.|.|.:......:||.:||.....:.:
plant   262 RFLVEHEEKLNEDQD--MDMMGVLLAACRDKNAECKITRNHIKSLFVDLVVAGTDTSRHATQWTM 324

  Fly   319 YELACHQDIQDKLRTEINTVLKQHNGKLDYDSMREMTYLEKVIDETMRKRPVVGHLIRVATQHYQ 383
            .|:.....:.:|:|.||.:|:.:.....:.| :..:.||:..:.|.:|..|......|.|.:.:.
plant   325 AEIINKPKVLEKVREEIYSVVGRTRLVQETD-LPSLPYLQATVKEGLRLHPPGPLFARTAREGFS 388

  Fly   384 HTNPKYNIEKGTGVIVPTLAIHHDPEFYPEPEKFIPERF----DEDQVQQRPACTFLPFGDGPRN 444
            ...  :.:.:.|.::|...|:..||..:.:|.:|.||||    .||  ::.....::|||.|.|.
plant   389 VGG--FYVPENTPLVVNAYAMMRDPGSWEDPNEFKPERFLGSGKED--EREHGLKYIPFGSGRRG 449

  Fly   445 CIGLRFGRMQVIVGMALLIHNFKFEFHPTK 474
            |.|:....:.|...:.:::..|.::....|
plant   450 CPGINLAYILVGTAIGVMVQCFDWKIKGNK 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a20NP_611002.3 p450 32..496 CDD:278495 100/483 (21%)
CYP705A23NP_188649.1 p450 26..504 CDD:386267 101/485 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D467733at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.