powered by:
Protein Alignment Cyp6a20 and Cyp3a71-ps
DIOPT Version :9
Sequence 1: | NP_611002.3 |
Gene: | Cyp6a20 / 36664 |
FlyBaseID: | FBgn0033980 |
Length: | 501 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_008767252.2 |
Gene: | Cyp3a71-ps / 690383 |
RGDID: | 1597309 |
Length: | 183 |
Species: | Rattus norvegicus |
Alignment Length: | 70 |
Identity: | 26/70 - (37%) |
Similarity: | 42/70 - (60%) |
Gaps: | 1/70 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 138 FTSGKMKTMFPTILTVGDELIRVFGETASADSDSMEITNVVARFTADVIGSCAFGLDCHSLSDPK 202
|||||:|.|||.|...||.|::...:.|. ....:.:.::...::.|||.|.:||::..||::||
Rat 2 FTSGKLKVMFPIIKLYGDILVKYLRQEAE-KGKPVSVKDIFGAYSMDVITSTSFGVNVDSLNNPK 65
Fly 203 AKFVQ 207
..||:
Rat 66 DPFVE 70
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D264519at33208 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.