DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a9 and CYP4F2

DIOPT Version :9

Sequence 1:NP_523748.2 Gene:Cyp6a9 / 36663 FlyBaseID:FBgn0013771 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_001073.3 Gene:CYP4F2 / 8529 HGNCID:2645 Length:520 Species:Homo sapiens


Alignment Length:557 Identity:146/557 - (26%)
Similarity:251/557 - (45%) Gaps:103/557 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGVYSVLLA--IVVVLVG--YLL---LKWRRALH-----------------YW--QNLDIPCEEP 39
            :|::.|..:  ::::|||  :||   |.|..|.:                 :|  |.:..|.||.
Human     9 LGLWPVAASPWLLLLLVGASWLLAHVLAWTYAFYDNCRRLRCFPQPPRRNWFWGHQGMVNPTEEG 73

  Fly    40 HILMGSLTGVQTSRSFSAIWMDYYNKFRGTGPFAGFYWFQRPGILVLDISLAKLILIKEFNKFTD 104
            ..::..|  |.|......:||         ||.:.......|.|:...|:.:..|..|      |
Human    74 MRVLTQL--VATYPQGFKVWM---------GPISPLLSLCHPDIIRSVINASAAIAPK------D 121

  Fly   105 RGFYHNTEDDPLSGQ-LFLLDGQKWKSMRSKLSYTFTSGKMK-YMFPTVVKVGHEFIEVFGQ--- 164
            :.||...|  |..|. |.|..|.||...|..|:..|....:| ||     |:.:|.:.:...   
Human   122 KFFYSFLE--PWLGDGLLLSAGDKWSRHRRMLTPAFHFNILKPYM-----KIFNESVNIMHAKWQ 179

  Fly   165 --AMEKSPIVEVRDILARFTTDVIGTCAFGIECSSLKDPEAEF--RVMGRRAIFEQRHGPI--GI 223
              |.|.|..:::.:.::..|.|.:..|.|..: |..::..:|:  .::...|:..:||..|  .|
Human   180 LLASEGSACLDMFEHISLMTLDSLQKCVFSFD-SHCQEKPSEYIAAILELSALVSKRHHEILLHI 243

  Fly   224 AFI-------NSFQNLARRLH--MKITLEEAEHFFLRIVRETVA-------FREKNNIRRNDFMD 272
            .|:       ..|:...|.:|  ....::|.        |.|:.       .:.|...:..||:|
Human   244 DFLYYLTPDGQRFRRACRLVHDFTDAVIQER--------RRTLPSQGVDDFLQAKAKSKTLDFID 300

  Fly   273 QLIDLKNSPLTKSESGESVNLTIEEMAAQAFVFFGAGFETSSTTMGFALYELAQHQDIQDRVRKE 337
            .|:      |:|.|.|:  .|:.|::.|:|..|...|.:|:::.:.:.||.||:|.:.|:|.|:|
Human   301 VLL------LSKDEDGK--KLSDEDIRAEADTFMFEGHDTTASGLSWVLYHLAKHPEYQERCRQE 357

  Fly   338 CQEVI-GKYNGEITYESMKDMVYLDQVISETLRLYTVLPVLNRECLEDYEVP-GHPKYVIKKGMP 400
            .||:: .:...||.::.:..:.:|...:.|:|||:..:||::|...:|..:| |.   ||.||:.
Human   358 VQELLKDREPKEIEWDDLAHLPFLTMCMKESLRLHPPVPVISRHVTQDIVLPDGR---VIPKGII 419

  Fly   401 VLIPCGAMHRDEKLYANPNTFNPDNFSPERVKERDSVEWLPFGDGPRNCIGMRFGQMQARSGLAL 465
            .||.....|.:..::.:|..::|..|.||.:|||..:.::||..|||||||..|...:.:..|||
Human   420 CLISVFGTHHNPAVWPDPEVYDPFRFDPENIKERSPLAFIPFSAGPRNCIGQTFAMAEMKVVLAL 484

  Fly   466 LINRFKFSVCEQTTIPIVYSKKTFLISSETGIFLKVE 502
            .:.||:  |....|.|  ..|...::.:|.|::|:||
Human   485 TLLRFR--VLPDHTEP--RRKPELVLRAEGGLWLRVE 517

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a9NP_523748.2 p450 35..499 CDD:278495 131/492 (27%)
CYP4F2NP_001073.3 DUF4175 4..>57 CDD:372724 10/47 (21%)
p450 52..515 CDD:365848 133/510 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.