DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a9 and CYP89A7

DIOPT Version :9

Sequence 1:NP_523748.2 Gene:Cyp6a9 / 36663 FlyBaseID:FBgn0013771 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_176673.1 Gene:CYP89A7 / 842801 AraportID:AT1G64930 Length:511 Species:Arabidopsis thaliana


Alignment Length:450 Identity:112/450 - (24%)
Similarity:182/450 - (40%) Gaps:78/450 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 GPFAGFYWFQRPGILVLDISLAKLILIKEFNKFTDRGFYHNTEDDPLSGQL--------FLLDGQ 126
            ||........||.|.|.|.|||...|:.....|.||     ....|:|..|        ..|.|.
plant    67 GPIITLRITSRPAIFVADGSLAHQALVLNGAVFADR-----PPAAPISKILSNNQHTITSCLYGV 126

  Fly   127 KWKSMRSKLSYTFTSGKMKYMFPTVVKVGHEFIEVFGQAMEKS----PIVEVRDILARFTTDVIG 187
            .|:.:|..::......:||    :...|.|..:|:....:.||    ||| |.|.|......|:.
plant   127 TWRLLRRNITEILHPSRMK----SYSHVRHWVLEILFDRLRKSGGEEPIV-VFDHLHYAMFAVLV 186

  Fly   188 TCAFGIECSSLKDPEAEFRVMGRRAIFEQRHGPIGIAFINSFQNLARRLHMKITLEEAEHFF--- 249
            ...||.:....:..:.|         :.||...:|.|.. |..||..:....|..:..|.||   
plant   187 LMCFGDKLDEKQIKQVE---------YVQRQMLLGFARY-SILNLCPKFTKLILRKRWEEFFQMR 241

  Fly   250 -------LRIV---RETVAFREKNNIRRND--------FMDQLIDLKNSPLTKSESGESVNLTIE 296
                   ||::   |:.|..|:|.:....:        ::|.|:|:: .|..|.:..|      :
plant   242 REQQDVLLRLIYARRKIVEERKKRSSEEEEENKEYVQSYVDTLLDVE-LPDEKRKLNE------D 299

  Fly   297 EMAAQAFVFFGAGFETSSTTMGFALYELAQHQDIQDRVRKECQEVIGKYNGEITYESMKDMVYLD 361
            |:.:....|..||.:|::|.:.:.:..|.::|:||:|:.:|...|:|:....:..:..:.|.||.
plant   300 EIVSLCSEFLIAGSDTTATVLQWIMANLVKNQEIQERLYEEITNVVGEEAKVVEEKDTQKMPYLK 364

  Fly   362 QVISETLRLY----TVLP--VLNRECLEDYEVPGHPKYVIKKGMPVLIPCGAMHRDEKLYANPNT 420
            .|:.|.||.:    ||||  |.....|..|:||       ||| .:......:.||.|::..|..
plant   365 AVVMEALRRHPPGNTVLPHSVTEDTVLGGYKVP-------KKG-TINFLVAEIGRDPKVWEEPMA 421

  Fly   421 FNPDNFSPER----VKERDSVEWLPFGDGPRNCIGMRFGQMQARSGLALLINRFKFSVCE 476
            |.|:.|..|.    :.....::.:|||.|.|.|.|:....:.....:|.::..|::...|
plant   422 FKPERFMGEEEAVDITGSRGIKMMPFGAGRRICPGIGLAMLHLEYYVANMVREFQWKEVE 481

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a9NP_523748.2 p450 35..499 CDD:278495 111/449 (25%)
CYP89A7NP_176673.1 CYP77_89 65..502 CDD:410698 111/449 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D467733at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.