DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a9 and CYP97A3

DIOPT Version :9

Sequence 1:NP_523748.2 Gene:Cyp6a9 / 36663 FlyBaseID:FBgn0013771 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_564384.1 Gene:CYP97A3 / 840067 AraportID:AT1G31800 Length:595 Species:Arabidopsis thaliana


Alignment Length:468 Identity:120/468 - (25%)
Similarity:202/468 - (43%) Gaps:81/468 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 GSLTGVQTSRSFSAIW---MDYYNKFRGT-GPFAGFYWFQRPGILVLDISLAKLILIKEFNKFTD 104
            ||:..|:....|..::   :.|...||.| ||        :..::|.|.|:||.|| |:..|...
plant   118 GSIQAVRNEAFFIPLYELFLTYGGIFRLTFGP--------KSFLIVSDPSIAKHIL-KDNAKAYS 173

  Fly   105 RGFYHNTEDDPLSGQLFLLDGQKWKSMRSKLSYTFTSGKMKYMFPTVVKVGHE-----FIEVFGQ 164
            :|......|..:...|...||:.|:..|.                .:|...|:     .|.:||:
plant   174 KGILAEILDFVMGKGLIPADGEIWRRRRR----------------AIVPALHQKYVAAMISLFGE 222

  Fly   165 AME-----------KSPIVEVRDILARFTTDVIGTCAFGIECSSLKDP----EAEFRVMGRRAIF 214
            |.:           |...||:..:.:|.|.|:||...|..:..||.:.    ||.:.|:  |...
plant   223 ASDRLCQKLDAAALKGEEVEMESLFSRLTLDIIGKAVFNYDFDSLTNDTGVIEAVYTVL--REAE 285

  Fly   215 EQRHGPIGIAFINSFQNLARR-----LHMKI---TLEEAEHFFLRIV-RETVAFREK-NNIRRND 269
            ::...||.:..|..:::::.|     ..:|:   ||::......|:| .|.:.|.|: .|.|...
plant   286 DRSVSPIPVWDIPIWKDISPRQRKVATSLKLINDTLDDLIATCKRMVEEEELQFHEEYMNERDPS 350

  Fly   270 FMDQLIDLKNSPLTKSESGESVNLTIEEMAAQAFVFFGAGFETSSTTMGFALYELAQHQDIQDRV 334
            .:..|:          .||:.|  :.:::.........||.|||:..:.:..|.|.....:..::
plant   351 ILHFLL----------ASGDDV--SSKQLRDDLMTMLIAGHETSAAVLTWTFYLLTTEPSVVAKL 403

  Fly   335 RKECQEVIGKYNGEITYESMKDMVYLDQVISETLRLYTVLPVLNRECLEDYEVPGHPKYVIKKGM 399
            ::|...|||  :...|.:.||.:.|..:|::|:||||...|||.|..: |.::.|  :|.||:|.
plant   404 QEEVDSVIG--DRFPTIQDMKKLKYTTRVMNESLRLYPQPPVLIRRSI-DNDILG--EYPIKRGE 463

  Fly   400 PVLIPCGAMHRDEKLYANPNTFNPDNF---SPERVKERDSVEWLPFGDGPRNCIGMRFGQMQARS 461
            .:.|....:||....:.:...|||:.:   .|...:...:..:||||.|||.|||..|...:...
plant   464 DIFISVWNLHRSPLHWDDAEKFNPERWPLDGPNPNETNQNFSYLPFGGGPRKCIGDMFASFENVV 528

  Fly   462 GLALLINRFKFSV 474
            .:|:||.||.|.:
plant   529 AIAMLIRRFNFQI 541

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a9NP_523748.2 p450 35..499 CDD:278495 120/468 (26%)
CYP97A3NP_564384.1 PLN02738 1..595 CDD:215393 120/468 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3438
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.