DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a9 and CYP72C1

DIOPT Version :9

Sequence 1:NP_523748.2 Gene:Cyp6a9 / 36663 FlyBaseID:FBgn0013771 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_001319024.1 Gene:CYP72C1 / 838276 AraportID:AT1G17060 Length:313 Species:Arabidopsis thaliana


Alignment Length:329 Identity:68/329 - (20%)
Similarity:114/329 - (34%) Gaps:93/329 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLAIVVV----LVGYLLL----KWR----------RALHYWQNLDIPCEEPHILMGSLTGV---- 49
            :|.|:.|    |:|:|:|    .||          |...|.:..........||||.:...    
plant     1 MLEIITVRKVFLIGFLILILNWVWRAVNWVWLRPKRLEKYLKKQGFSGNSYRILMGDMRESNQMD 65

  Fly    50 QTSRSFS-AIWMDYYNKFRGTGPFAG----------FYWF-QRPGILVLDISLAKLILIKEFNKF 102
            |.:.|.. .:..|:..:..   ||..          |.|: ..|.::|:|....:.|:.|     
plant    66 QVAHSLPLPLDADFLPRMM---PFLHHTVLKHGKKCFTWYGPYPNVIVMDPETLREIMSK----- 122

  Fly   103 TDRGFYHNTEDDP---------LSGQLFLLDGQKWKSMRSKLSYTFTSGKMKYMFPTVVKVGHEF 158
                  |.....|         ||| |...:|.||...||.|:..|....:|.:.|.......|.
plant   123 ------HELFPKPKIGSHNHVFLSG-LLNHEGPKWSKHRSILNPAFRIDNLKSILPAFNSSCKEM 180

  Fly   159 IEVFGQ------AMEKSPIVEVRDILARFTTDVIGTCAF------GIECSSLKDPEAEFRVMGRR 211
            :|.:.:      .||........|:    |.:::...:|      ||:...::..:.:..::..|
plant   181 LEEWERLASAKGTMELDSWTHCHDL----TRNMLARASFGDSYKDGIKIFEIQQEQIDLGLLAIR 241

  Fly   212 AIFEQRHGPIGIAFINSFQNLARRLHMKITLEEAEHFFLRIVRETVAFREKNNIRRNDFMDQLID 276
            |::..     |..|:.:..|  ||      |.|.|.....:.:..:..:|: .|:|....|    
plant   242 AVYIP-----GSKFLPTKFN--RR------LRETERDMRAMFKAMIETKEE-EIKRGRGTD---- 288

  Fly   277 LKNS 280
             |||
plant   289 -KNS 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a9NP_523748.2 p450 35..499 CDD:278495 57/283 (20%)
CYP72C1NP_001319024.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3438
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.