DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a9 and CYP735A1

DIOPT Version :9

Sequence 1:NP_523748.2 Gene:Cyp6a9 / 36663 FlyBaseID:FBgn0013771 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_198661.1 Gene:CYP735A1 / 833833 AraportID:AT5G38450 Length:518 Species:Arabidopsis thaliana


Alignment Length:526 Identity:130/526 - (24%)
Similarity:228/526 - (43%) Gaps:77/526 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SVLLAIVVVLVGYLLLKWRRALH-----YW----------QNLDIPCEEPHILMGSLTGVQTSRS 54
            ::|.:::|:.|..:|    |.|:     ||          :...:...:|..|.|::..:....|
plant     4 TILKSLLVIFVTTIL----RVLYDTISCYWLTPRRIKKIMEQQGVTGPKPRPLTGNILEISAMVS 64

  Fly    55 FSA--------------------IWMDYYNK----FRGTGPFAGFYWFQRPGILVLDISLAKLIL 95
            .||                    .|...|.|    :.||.          |.:.:.:..|.|.:|
plant    65 QSASKDCDSIHHDIVGRLLPHYVAWSKQYGKRFIVWNGTD----------PRLCLTETELIKELL 119

  Fly    96 IKEFNKFTDRGFYHNTEDDPLSGQ-LFLLDGQKWKSMRSKLSYTFTSGKMKYMFPTVVKVGHEFI 159
            :|. |..:.|.:..........|: |.:.:||.|...|...:..||..::|.....:|:...:.:
plant   120 MKH-NGVSGRSWLQQQGTKNFIGRGLLMANGQDWHHQRHLAAPAFTGERLKGYARHMVECTSKLV 183

  Fly   160 EVFGQAM-EKSPIVEVRDILARFTTDVIGTCAFGIECSSLKDPEAEFRVMGRRAIFEQRH--GPI 221
            |...:.: |.:..||:.:.:.:.|.|:|....||......|:......|:.||.....||  .| 
plant   184 ERLRKEVGEGANEVEIGEEMHKLTADIISRTKFGSSFEKGKELFNHLTVLQRRCAQATRHLCFP- 247

  Fly   222 GIAFINSFQNLARRLHMKITLEEAEHFFLRIV--RETVAFREKNNIRRNDFMDQLIDLKNSPLTK 284
            |..|:.|..|    ..:|...:|.|...:.|:  |...|...:::...:|.:..|::..:.....
plant   248 GSRFLPSKYN----REIKSLKKEVERLLIEIIQSRRDCAEMGRSSTHGDDLLGLLLNEMDIDKNN 308

  Fly   285 SESGESVNLTIEEMAAQAFVFFGAGFETSSTTMGFALYELAQHQDIQDRVRKECQEVIGKYNGEI 349
            :.:..::.|.::|..    .||.||.||::..:.:....||.:...|::||:|.:||.|: ||..
plant   309 NNNNNNLQLIMDECK----TFFFAGHETTALLLTWTTMLLADNPTWQEKVREEVREVFGR-NGLP 368

  Fly   350 TYESMKDMVYLDQVISETLRLYTVLPVLNRECLEDYEVPGHPKYVIKKGMPVLIPCGAMHRDEKL 414
            :.:.:..:..|.:||:|:||||....:|.|...||.::   ....|.||:.:.||..|:|..|:|
plant   369 SVDQLSKLTSLSKVINESLRLYPPATLLPRMAFEDLKL---GDLTIPKGLSIWIPVLAIHHSEEL 430

  Fly   415 YA-NPNTFNPDNFSPERVKERDSVEWLPFGDGPRNCIGMRFGQMQARSGLALLINRFKFSVCEQ- 477
            :. :.|.|||:.|.....  .....::||..|||||||.:|..|:|:..||.||::|.|::.:. 
plant   431 WGKDANQFNPERFGGRPF--ASGRHFIPFAAGPRNCIGQQFALMEAKIILATLISKFNFTISKNY 493

  Fly   478 TTIPIV 483
            ...|||
plant   494 RHAPIV 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a9NP_523748.2 p450 35..499 CDD:278495 122/481 (25%)
CYP735A1NP_198661.1 PLN02290 1..518 CDD:215164 130/526 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3438
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.