DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a9 and LUT1

DIOPT Version :9

Sequence 1:NP_523748.2 Gene:Cyp6a9 / 36663 FlyBaseID:FBgn0013771 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_190881.2 Gene:LUT1 / 824479 AraportID:AT3G53130 Length:539 Species:Arabidopsis thaliana


Alignment Length:475 Identity:102/475 - (21%)
Similarity:188/475 - (39%) Gaps:70/475 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 WMDYYNKFRGTGPFAGFYWFQRPGILVLDISLAKLILIKEFNKFTDRGFYHNTEDDPLSGQLFLL 123
            ||:.|      ||........|..::|.|.::||.:| :.:.|:. :|......:........:.
plant   104 WMNEY------GPIYRLAAGPRNFVIVSDPAIAKHVL-RNYPKYA-KGLVAEVSEFLFGSGFAIA 160

  Fly   124 DGQKWKSMR----SKLSYTFTSGKMKYMFPTVVKVGHEFIEVFGQAMEKSPIVEVRDILARFTTD 184
            :|..|.:.|    ..|...:.|..::.:|   .|.....:|......|....|.:....::.|.|
plant   161 EGPLWTARRRAVVPSLHRRYLSVIVERVF---CKCAERLVEKLQPYAEDGSAVNMEAKFSQMTLD 222

  Fly   185 VIGTCAFGIECSSLKD------------PEAEFRVMGRRAIFEQRHGPIGIAFINSFQNLARRLH 237
            |||...|.....||..            .|||.|.......::             ...|.:.:.
plant   223 VIGLSLFNYNFDSLTTDSPVIEAVYTALKEAELRSTDLLPYWK-------------IDALCKIVP 274

  Fly   238 MKITLEEAEHFFLRIVRETV----------AFREKNNIRRNDFM-DQLIDLKNSPLTKSESGESV 291
            .::..|:|    :.::||||          ..||...|...::: |....:....|...|...||
plant   275 RQVKAEKA----VTLIRETVEDLIAKCKEIVEREGERINDEEYVNDADPSILRFLLASREEVSSV 335

  Fly   292 NLTIEEMAAQAFVFFGAGFETSSTTMGFALYELAQHQDIQDRVRKECQEVIGKYNGEITYESMKD 356
            .|..:.::     ...||.||:.:.:.:.||.|:::.....:.::|...|:...|.  .:|.:|:
plant   336 QLRDDLLS-----MLVAGHETTGSVLTWTLYLLSKNSSALRKAQEEVDRVLEGRNP--AFEDIKE 393

  Fly   357 MVYLDQVISETLRLYTVLPVLNRECLEDYEVPGHPKYVIKKGMPVLIPCGAMHRDEKLYANPNTF 421
            :.|:.:.|:|::|||...|||.|.......:||:  |.:..|..::|....:||..:::.....|
plant   394 LKYITRCINESMRLYPHPPVLIRRAQVPDILPGN--YKVNTGQDIMISVYNIHRSSEVWEKAEEF 456

  Fly   422 NPDNFSPERV---KERDSVEWLPFGDGPRNCIGMRFGQMQARSGLALLINRFKFSVCEQTTIPIV 483
            .|:.|..:..   :.....:::||..|||.|:|.:|..|:|...||:.:.|....:....||.:.
plant   457 LPERFDIDGAIPNETNTDFKFIPFSGGPRKCVGDQFALMEAIVALAVFLQRLNVELVPDQTISMT 521

  Fly   484 YSKKTFLISSETGIFLKVER 503
            ...   .|.:..|:::||.:
plant   522 TGA---TIHTTNGLYMKVSQ 538

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a9NP_523748.2 p450 35..499 CDD:278495 100/469 (21%)
LUT1NP_190881.2 PLN02936 56..539 CDD:178524 102/475 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3438
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.