DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a9 and CYP705A32

DIOPT Version :9

Sequence 1:NP_523748.2 Gene:Cyp6a9 / 36663 FlyBaseID:FBgn0013771 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_188731.1 Gene:CYP705A32 / 821645 AraportID:AT3G20950 Length:526 Species:Arabidopsis thaliana


Alignment Length:486 Identity:115/486 - (23%)
Similarity:199/486 - (40%) Gaps:87/486 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 DIPCEEPHILMGS--------LTGVQTSRSFSAIWMDYYNKFRGTGPFAGFYWFQRPGILVLDIS 89
            |:|...|...:||        |......:||..|...|       ||......|..|.:|....|
plant    41 DLPPSPPSFPVGSPQSNNLHLLLSALVHKSFQKISYKY-------GPLLHLRVFHVPIVLASSAS 98

  Fly    90 LAKLILIKEFNKFTDRGFYHNTEDDPL----SGQLFLLDGQKWKSMRSKLSYTFTSGKMKYMFPT 150
            :|..|...:....:.||  |....:.|    |...|...|..:|.|| ||..|      |.:.|.
plant    99 VAYEIFKAQDVNVSSRG--HAPAGESLLFGSSSFFFAPYGDYFKFMR-KLIAT------KLLGPQ 154

  Fly   151 VV----KVGHEFIEVF-----GQAMEKSPIVEVRDILARFTTDVIGTCAFGIECSSLKDPEAEFR 206
            .:    |:..:.::.|     .:||:|.. |::.:..|:...::|.....|..||. .:.||| |
plant   155 ALERSRKIRADELDRFYRNLLDKAMKKES-VDIVEEAAKLNNNIICKMIMGRSCSE-DNGEAE-R 216

  Fly   207 VMG-------------RRAIFEQRHGPIGIA-FINSFQNLAR--RLHMKITLEEAEHFFLRIVRE 255
            |.|             ...||::....:||: |....::::|  .|..||.:|..|         
plant   217 VRGLVIESTALTKQIFLGMIFDKPLKKLGISLFQKDIKSVSRFDELLEKILVEHEE--------- 272

  Fly   256 TVAFREKNNIRRNDFMDQLIDLKNSPLTKSESGESVNLTIEEMAAQAFVFFGAGFETSSTTMGFA 320
                |...:.:.||.||.|::      ...:......:|...:.:.......||.:||:.|:.:.
plant   273 ----RMGKHYKANDMMDLLLE------AYGDENAEYKITRNHIKSLFVDLVIAGTDTSAQTIEWT 327

  Fly   321 LYELAQHQDIQDRVRKECQEVIGKYNGEITYES-MKDMVYLDQVISETLRLYTVLPVLNRECLED 384
            :.||..:.:|.:|:|:|.:.|:|  |..:..|: :.::.||..|:.|.|||:....|..|...|.
plant   328 MAELINNPNILERLREEIESVVG--NTRLVQETDLPNLPYLQAVVKEGLRLHPPGAVFLRTFQER 390

  Fly   385 YEVPGHPKYVIKKGMPVLIPCGAMHRDEKLYANPNTFNPDNF-SPERVKERDSV-----EWLPFG 443
            .|:.|.  |:.:|.: :::...|:.||.||:.:|..|.|:.| :..|..:.|.:     :::||.
plant   391 CELKGF--YIPEKTL-LVVNVYAIMRDPKLWEDPEEFKPERFIASSRSGQEDEIREEVLKYMPFS 452

  Fly   444 DGPRNCIGMRFGQMQARSGLALLINRFKFSV 474
            .|.|.|.|.....:...:.:.::...|.:.:
plant   453 TGRRGCPGSNLAYVSVGTAIGVMAQCFDWRI 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a9NP_523748.2 p450 35..499 CDD:278495 114/484 (24%)
CYP705A32NP_188731.1 p450 16..514 CDD:299894 115/486 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D467733at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.