DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a9 and CYP72A8

DIOPT Version :9

Sequence 1:NP_523748.2 Gene:Cyp6a9 / 36663 FlyBaseID:FBgn0013771 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_188080.1 Gene:CYP72A8 / 820690 AraportID:AT3G14620 Length:515 Species:Arabidopsis thaliana


Alignment Length:374 Identity:104/374 - (27%)
Similarity:182/374 - (48%) Gaps:42/374 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 LLDGQKWKSMRSKLSYTFTSGKMKYMFPTVVKVGHEFIEVFGQAMEK---SPIVEVRDILARFTT 183
            |.:|:||...|..::.:|...|:|.|.|...:...|.|..:.:.:.:   |..::|...|...|:
plant   146 LYEGEKWSKHRKIINPSFHLEKLKIMIPAFYESCSEMISKWEKLVTEQGSSNEIDVWPYLGDLTS 210

  Fly   184 DVIGTCAFGIECSSLKDPEAEFRV---MGRRAIFEQRHGPIGIAFINSFQNLARR--LHMKITLE 243
            |||...|||   ||.::.:..|.:   .|||.:     ..:.:|||...:.|..:  |.|:...:
plant   211 DVISRTAFG---SSYEEGKRIFELQEEQGRRVL-----KALELAFIPGMRFLPTKNNLRMRQINK 267

  Fly   244 EAEHFFLRIVRETVAFREKNNIRRNDFMDQLIDLKNSPLTKSESGESVNLTIEEMAAQAFVFFGA 308
            |.:.....|:.:.....:.....:||.:..|::        |.||:. .::||::..:..:|..|
plant   268 EVKSRLREIIMKRQRGMDTGEAPKNDLLGILLE--------SNSGDH-GMSIEDVVEECRLFHFA 323

  Fly   309 GFETSSTTMGFALYELAQHQDIQDRVRKECQEVIGKYNGEITYESMKDMVYLDQVISETLRLYTV 373
            |.||::..:.:.:..|:.||..||:.|:|..:|||| |.:..::::..:..:..:::|.||||..
plant   324 GQETTAVLLVWTMIMLSHHQKWQDQAREEILKVIGK-NNKPNFDALSRLKTMSMILNEVLRLYPP 387

  Fly   374 LPVLNR------ECLEDYEVPGHPKYVIKKGMPVLIPCGAMHRDEKLYA-NPNTFNPDNFSPERV 431
            ..:|.|      :..||..:||        |..|:||...:|||.:|:. :.:.|||:.|:....
plant   388 GILLGRTVEKETKLGEDMTLPG--------GAQVVIPVLMVHRDPELWGEDVHEFNPERFADGIS 444

  Fly   432 K-ERDSVEWLPFGDGPRNCIGMRFGQMQARSGLALLINRFKFSVCEQTT 479
            | .::.|.:||||.|||.|.|..|..|:|:..|.|::.||.|.:....|
plant   445 KATKNQVSFLPFGWGPRFCPGQNFALMEAKMALVLILQRFSFELSPSYT 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a9NP_523748.2 p450 35..499 CDD:278495 104/374 (28%)
CYP72A8NP_188080.1 p450 26..515 CDD:299894 104/374 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3438
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.