DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a9 and CYP705A8

DIOPT Version :9

Sequence 1:NP_523748.2 Gene:Cyp6a9 / 36663 FlyBaseID:FBgn0013771 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_180268.1 Gene:CYP705A8 / 817242 AraportID:AT2G27000 Length:514 Species:Arabidopsis thaliana


Alignment Length:514 Identity:112/514 - (21%)
Similarity:212/514 - (41%) Gaps:97/514 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLLAIVVVLVGYLLLKWRRALHYWQNLDIPCEEPHI-LMG---SLTGVQTSRSFSAIWMDYYNKF 66
            :||.::.:|......|..:     ...::|...|.: ::|   .|..:...||...:...|    
plant    16 ILLCLLSILCYSFFFKKPK-----DGFNLPPSPPSLPIIGHLHHLLSLFMHRSLQKLSSKY---- 71

  Fly    67 RGTGPFAGFYWFQRPGILVLDISLAKLILIKEFNKFTDRGFYHNTEDDPLS-GQLFLLD------ 124
               ||....:.|..|.:||...|:|       :..|..:....:|.|.|.: |.|||..      
plant    72 ---GPLLYLHVFNVPILLVSSPSIA-------YEIFRAQDVNVSTRDFPTNEGSLFLGSFSFITA 126

  Fly   125 --GQKWKSMRSKLSYTFTSGKMKYMFPTVV---------KVGHEFIEVFGQAMEKSPIVEVRDIL 178
              |:.||.|: ||..|      |.:.|..:         :|...:..:..:||:|.. ||:.|..
plant   127 PYGEYWKFMK-KLIVT------KLLGPQALERSQRIRANEVERFYSNLLDKAMKKES-VEIADEA 183

  Fly   179 ARFTTDVIGTCAFGIECSSLKDPEAEFRVMG-------------RRAIFEQRHGPIGIAFINSFQ 230
            .:...::|.....|..||. ::.||| |:.|             ..||..:....|||       
plant   184 MKLVNNIICKMIMGRTCSE-ENGEAE-RIRGLVTKSDALLKKFLLAAILRKPLKKIGI------- 239

  Fly   231 NLARRLHMKITLEEAEHFFLRIVRETVAFREKNNIRRN----DFMDQLIDLKNSPLTKSESGESV 291
            .|.:::.|.|:|:..|      |.|.:....:..:..|    |.||:|:::      ..:.....
plant   240 TLFKKVFMDISLKFDE------VLEKILVENEERLEENQQGTDIMDKLLEV------YGDKTSEY 292

  Fly   292 NLTIEEMAAQAFVFFGAGFETSSTTMGFALYELAQHQDIQDRVRKECQEVIGKYNGEITYESMKD 356
            .:|.:.:.:.....|.||.:|::.|:.:.:.|:..:..|.:|:|:|...|:|| ...|....:.:
plant   293 KITRDHIKSLFVDLFFAGTDTATHTIEWTMAEIMNNSLILERLREEIDSVVGK-TRLIQETDLPN 356

  Fly   357 MVYLDQVISETLRLYTVLPVLNRECLEDYEVPGHPKYVIKKGMPVLIPCGAMHRDEKLYANPNTF 421
            ::||...:.|.|||:..:|::.|...:...:.|   :.|.|...:::...|:.||...:.:|..|
plant   357 LLYLQATVKEGLRLHPTIPLVLRTFQDGCTIGG---FSIPKKTKLVVNGYAIMRDPDNWEDPLEF 418

  Fly   422 NPDNF-SPERVKERDSV-----EWLPFGDGPRNCIGMRFGQMQARSGLALLINRFKFSV 474
            .|:.| :..|..::|::     ::|.||.|.|.|.|:....:...:.:.:::..|.:.:
plant   419 KPERFLASSRSSQKDAIKEEVLKYLSFGSGRRGCPGVNLAYVSVETAIGVMVQCFDWKI 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a9NP_523748.2 p450 35..499 CDD:278495 108/485 (22%)
CYP705A8NP_180268.1 p450 55..506 CDD:299894 105/470 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D467733at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.