DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a9 and Cyp20a1

DIOPT Version :9

Sequence 1:NP_523748.2 Gene:Cyp6a9 / 36663 FlyBaseID:FBgn0013771 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_084289.1 Gene:Cyp20a1 / 77951 MGIID:1925201 Length:462 Species:Mus musculus


Alignment Length:478 Identity:115/478 - (24%)
Similarity:201/478 - (42%) Gaps:84/478 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 PCEEPHILMGSLTGVQTSRSFSAIWMDYYNKFRGTGPFAGFYWFQRPGILVLDISLAKLILIKEF 99
            |.||..   |:|..:..|.|.....::.:.::   ||...| ||.|.    |.:||....::|:.
Mouse    37 PTEEKD---GNLPDIVNSGSLHEFLVNLHERY---GPVVSF-WFGRR----LVVSLGTTDVLKQH 90

  Fly   100 NKFTDRGFYHNTEDDPLSGQLFLLDGQKWKS---------MRSKLSYTFTSGKMKYMFPTVVKVG 155
                   |..|...||....|..|.|  ::|         :|.||.....:..:...||.::::.
Mouse    91 -------FNPNKTSDPFETMLKSLLG--YQSGGGSAGEDHVRRKLYGDAVTASLHSNFPLLLQLS 146

  Fly   156 HEFIEVFGQAMEKSPIVEVRDILA---RFTTD-VIGTCAFGIECSSLKDPEAEFRVMGRRAIFEQ 216
            .|.::.:....|...|...:.:|.   :|.|. |:|        |:.:|.:...|       |::
Mouse   147 EELLDKWLSYPETQHIPLSQHMLGFALKFVTRMVLG--------STFEDEQEVIR-------FQK 196

  Fly   217 RHG----PIGIAFINSF--QNLARRLHMKITLEEAEHFFLRIVRETVAFREKNNIRRNDFMDQLI 275
            .||    .||..|::..  :|..|:...:..|.:.|....:|::|    |:..|.|::.|:|.|.
Mouse   197 IHGTVWSEIGKGFLDGSLDKNTTRKKQYQEALMQLESTLKKIIKE----RKGGNFRQHTFIDSLT 257

  Fly   276 DLKNSPLTKSESGESVNLTIEEMAAQAFVFFGAGFETSSTTMGFALYELAQHQDIQDRVRKECQE 340
            ..|              |..:::.....||..|....::....:.::.|....::|.::.||..:
Mouse   258 QGK--------------LNEQQILEDCVVFSLASCIITARLCTWTIHFLTTTGEVQKKLCKEIDQ 308

  Fly   341 VIGKYNGEITYESMKDMVYLDQVISETLRLYTVLPVLNRECLEDYEVPGHPKYVIKKGMPVLIPC 405
            |:|:  |.||.|.::.:.|..||:.||:|...:.||..|  |:|.|....| :||.|...||...
Mouse   309 VLGE--GPITSEKIEQLSYCQQVLFETVRTAKLTPVSAR--LQDIEGKVGP-FVIPKETLVLYAL 368

  Fly   406 GAMHRDEKLYANPNTFNPDNFSPERVKERDSVEWLPFGDGPRNCIGMRFGQMQARSGLALLINRF 470
            |.:.:|...:..|:.|:||.|:.|.|.:..|.  |.| .|...|..:||..|.....:::|:.|.
Mouse   369 GVVLQDPSTWPLPHRFDPDRFADEPVMKVFSS--LGF-SGTWECPELRFAYMVTAVLVSVLLKRL 430

  Fly   471 KFSVCEQTTIPIVYSKKTFLISS 493
            :....::.    |:..|..|::|
Mouse   431 RLLAVDRQ----VFEMKYELVTS 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a9NP_523748.2 p450 35..499 CDD:278495 115/478 (24%)
Cyp20a1NP_084289.1 p450 43..446 CDD:299894 110/464 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7447
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.