DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a9 and CYP4F12

DIOPT Version :9

Sequence 1:NP_523748.2 Gene:Cyp6a9 / 36663 FlyBaseID:FBgn0013771 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_076433.3 Gene:CYP4F12 / 66002 HGNCID:18857 Length:524 Species:Homo sapiens


Alignment Length:552 Identity:139/552 - (25%)
Similarity:243/552 - (44%) Gaps:111/552 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LAIVVVLVGYLL---LKWRRALH-----------------YWQNLDI--PCEEPHILMGSLTGVQ 50
            |.:::|:..:||   |.|..|.:                 :|.:|.:  |.||     |.....|
Human    20 LLLLLVVGSWLLARILAWTYAFYNNCRRLQCFPQPPKRNWFWGHLGLITPTEE-----GLKNSTQ 79

  Fly    51 TSRSFS---AIWMDYYNKFRGTGPFAGFYWFQRPGILVLDISLAKLILIKE--FNKFTDRGFYHN 110
            .|.::|   .:|:         ||...|.....|..:....:.:..|..|:  |.:|.       
Human    80 MSATYSQGFTVWL---------GPIIPFIVLCHPDTIRSITNASAAIAPKDNLFIRFL------- 128

  Fly   111 TEDDPLSGQLFLLD-GQKWKSMRSKLSYTFTSGKMKYMFPTVVKVGHEFIEVFGQ---------- 164
               .|..|:..||. |.||...|..|:..|....:|           .:|.:|.:          
Human   129 ---KPWLGEGILLSGGDKWSRHRRMLTPAFHFNILK-----------SYITIFNKSANIMLDKWQ 179

  Fly   165 --AMEKSPIVEVRDILARFTTDVIGTCAFGIECSSLKDPEAEF--RVMGRRAIFEQRHGPI--GI 223
              |.|.|..:::.:.::..|.|.:..|.|..: |..::..:|:  .::...|:.|:|...|  .:
Human   180 HLASEGSSRLDMFEHISLMTLDSLQKCIFSFD-SHCQERPSEYIATILELSALVEKRSQHILQHM 243

  Fly   224 AFINSFQNLARRLHMKITLEEAEHFF----LRIVRETVA-------FREKNNIRRNDFMDQLIDL 277
            .|:....:..||.|....|   .|.|    :|..|.|:.       |::|...:..||:|.|:  
Human   244 DFLYYLSHDGRRFHRACRL---VHDFTDAVIRERRRTLPTQGIDDFFKDKAKSKTLDFIDVLL-- 303

  Fly   278 KNSPLTKSESGESVNLTIEEMAAQAFVFFGAGFETSSTTMGFALYELAQHQDIQDRVRKECQEVI 342
                |:|.|.|::  |:.|::.|:|..|...|.:|:::.:.:.||.||:|.:.|:|.|:|.||::
Human   304 ----LSKDEDGKA--LSDEDIRAEADTFMFGGHDTTASGLSWVLYNLARHPEYQERCRQEVQELL 362

  Fly   343 -GKYNGEITYESMKDMVYLDQVISETLRLYTVLPVLNRECLEDYEVP-GHPKYVIKKGMPVLIPC 405
             .:...||.::.:..:.:|...:.|:|||:...|.::|.|.:|..:| |.   ||.||:..||..
Human   363 KDRDPKEIEWDDLAQLPFLTMCVKESLRLHPPAPFISRCCTQDIVLPDGR---VIPKGITCLIDI 424

  Fly   406 GAMHRDEKLYANPNTFNPDNFSPERVKERDSVEWLPFGDGPRNCIGMRFGQMQARSGLALLINRF 470
            ..:|.:..::.:|..::|..|.||..|.|..:.::||..|||||||..|...:.:..|||::..|
Human   425 IGVHHNPTVWPDPEVYDPFRFDPENSKGRSPLAFIPFSAGPRNCIGQAFAMAEMKVVLALMLLHF 489

  Fly   471 KFSVCEQTTIPIVYSKKTFLISSETGIFLKVE 502
            :|  ....|.|  ..|...::.:|.|::|:||
Human   490 RF--LPDHTEP--RRKLELIMRAEGGLWLRVE 517

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a9NP_523748.2 p450 35..499 CDD:278495 127/498 (26%)
CYP4F12NP_076433.3 p450 52..506 CDD:306555 127/507 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.