DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a9 and CYP3A43

DIOPT Version :9

Sequence 1:NP_523748.2 Gene:Cyp6a9 / 36663 FlyBaseID:FBgn0013771 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_073731.1 Gene:CYP3A43 / 64816 HGNCID:17450 Length:504 Species:Homo sapiens


Alignment Length:520 Identity:154/520 - (29%)
Similarity:255/520 - (49%) Gaps:62/520 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLLAIVVVLVGYLLLKWRRALHYWQNLDIPCEEPHILMGS----LTGV-----QTSRSFSAIWMD 61
            ||:|..:||   |.:....:...::.|.||...|...:|:    |.|:     :.:..:..:|  
Human    13 VLVATSLVL---LYIYGTHSHKLFKKLGIPGPTPLPFLGTILFYLRGLWNFDRECNEKYGEMW-- 72

  Fly    62 YYNKFRGTGPFAGFYWFQRPGILVLDISLAKLILIKE-FNKFTDR------GFYHNTEDDPLSGQ 119
                        |.|..|:|.::::|..:.|.:|:|| ::.||::      ||        |...
Human    73 ------------GLYEGQQPMLVIMDPDMIKTVLVKECYSVFTNQMPLGPMGF--------LKSA 117

  Fly   120 LFLLDGQKWKSMRSKLSYTFTSGKMKYMFPTVVKVGHEFIEVFGQAMEKSPIVEVRDILARFTTD 184
            |...:.::||.:|:.||..|||.|.|.|.|.:.:.|...:....|..|.|..:.::|....:|.|
Human   118 LSFAEDEEWKRIRTLLSPAFTSVKFKEMVPIISQCGDMLVRSLRQEAENSKSINLKDFFGAYTMD 182

  Fly   185 VIGTCAFGIECSSLKDPEAEFRVMGRRAIFEQRHGPIGIAFINSFQNLA---RRLHMKITLEEAE 246
            ||....||:...||.:|:..|....::.:......|. :..|:.|..|.   ..|::.:..::..
Human   183 VITGTLFGVNLDSLNNPQDPFLKNMKKLLKLDFLDPF-LLLISLFPFLTPVFEALNIGLFPKDVT 246

  Fly   247 HFFLRIVRETVAFREKNNIR-RNDFMDQLIDLKNSPLTKSESGESVNLTIEEMAAQAFVFFGAGF 310
            ||....:......|.|:..: |.||..|:||.:||..|||...    |:..|:.||:.:...|.:
Human   247 HFLKNSIERMKESRLKDKQKHRVDFFQQMIDSQNSKETKSHKA----LSDLELVAQSIIIIFAAY 307

  Fly   311 ETSSTTMGFALYELAQHQDIQDRVRKECQEVIGKYNGEITYESMKDMVYLDQVISETLRLYTVLP 375
            :|:|||:.|.:||||.|.|:|.::::|...|:.. ...:||:::..|.|||.|::|||||:.|:.
Human   308 DTTSTTLPFIMYELATHPDVQQKLQEEIDAVLPN-KAPVTYDALVQMEYLDMVVNETLRLFPVVS 371

  Fly   376 VLNRECLEDYEVPGHPKYVIKKGMPVLIPCGAMHRDEKLYANPNTFNPDN-FSPERVKERDSVE- 438
            .:.|.|.:|.|:.|   ..|.||:.|::|..|:|.|.|.:..|..|.|:: ||.   |.:||:: 
Human   372 RVTRVCKKDIEING---VFIPKGLAVMVPIYALHHDPKYWTEPEKFCPESRFSK---KNKDSIDL 430

  Fly   439 --WLPFGDGPRNCIGMRFGQMQARSGLALLINRFKFSVCEQTTIPIVYSKKTFLISSETGIFLKV 501
              ::|||.||||||||||.....:..:...:..|.|..|::|.||:...... ::..|..|.|||
Human   431 YRYIPFGAGPRNCIGMRFALTNIKLAVIRALQNFSFKPCKETQIPLKLDNLP-ILQPEKPIVLKV 494

  Fly   502  501
            Human   495  494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a9NP_523748.2 p450 35..499 CDD:278495 143/487 (29%)
CYP3A43NP_073731.1 p450 39..494 CDD:278495 144/489 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0158
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 1 1.000 - - FOG0000037
OrthoInspector 1 1.000 - - mtm8447
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X40
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.720

Return to query results.
Submit another query.