DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a9 and Cyp4f14

DIOPT Version :9

Sequence 1:NP_523748.2 Gene:Cyp6a9 / 36663 FlyBaseID:FBgn0013771 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_001191262.1 Gene:Cyp4f14 / 64385 MGIID:1927669 Length:524 Species:Mus musculus


Alignment Length:416 Identity:102/416 - (24%)
Similarity:197/416 - (47%) Gaps:59/416 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 LSGQLFLLDGQKWKSMRSKLSYTFTSGKMKYMFPTVVKVGHEFIEVFGQAMEK-----SPIVEVR 175
            |...|.:..|.||...|..|:..|....:|    ..||:.::...:.....::     |..:::.
Mouse   132 LGDGLLVSAGDKWSRHRRMLTPAFHFNILK----PYVKIFNDSTNIMHAKWQRLISDGSARLDMF 192

  Fly   176 DILARFTTDVIGTCAFGIECSSLKDPEAEF--RVMGRRAIFEQRH-------------GPIGIAF 225
            :.::..|.|.:..|.|..: |:.::..:|:  .::...|:..:||             .|.|:.|
Mouse   193 EHVSLMTLDSLQKCVFSFD-SNCQEKSSEYIAAILELSALVAKRHQQPLMFMDLLYNLTPDGMRF 256

  Fly   226 ------INSFQN-LARRLHMKITLEEAEHFFLRIVRETVAFREKNNIRRNDFMDQLIDLKNSPLT 283
                  ::.|.: :.|..|..:..:..:.|          .:.|...:..||:|.|:      |:
Mouse   257 RKACNVVHEFTDAVIRERHRTLPDQGLDDF----------LKSKAKSKTLDFIDVLL------LS 305

  Fly   284 KSESGESVNLTIEEMAAQAFVFFGAGFETSSTTMGFALYELAQHQDIQDRVRKECQEVI-GKYNG 347
            |.|.|:  .|:.|::.|:|..|...|.:|:::.:.:.||.||:|.:.|:|.|:|.||:: |:...
Mouse   306 KDEDGK--ELSDEDIRAEADTFMFEGHDTTASGLSWILYNLARHPEYQERCRQEVQELLRGREPE 368

  Fly   348 EITYESMKDMVYLDQVISETLRLYTVLPVLNRECLEDYEVP-GHPKYVIKKGMPVLIPCGAMHRD 411
            ||.::.:..:.:|...|.|:|||:..:.|::|.|.:|..:| |.   .|.||:..||....:|.:
Mouse   369 EIEWDDLAQLPFLTMCIKESLRLHPPVTVISRCCTQDILLPDGR---TIPKGIICLISIFGIHHN 430

  Fly   412 EKLYANPNTFNPDNFSPERVKERDSVEWLPFGDGPRNCIGMRFGQMQARSGLALLINRFKFSVCE 476
            ..::.:|..::|..|.||.:|:...:.::||..|||||||..|...:.:..|||.:.||:....:
Mouse   431 PSVWPDPEVYDPFRFDPENIKDSSPLAFIPFSAGPRNCIGQTFAMSEMKVALALTLLRFRLLPDD 495

  Fly   477 QTTIPIVYSKKTFLISSETGIFLKVE 502
            :..    ..:...::.:|.|::|:||
Mouse   496 KEP----RRQPELILRAEGGLWLRVE 517

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a9NP_523748.2 p450 35..499 CDD:278495 99/411 (24%)
Cyp4f14NP_001191262.1 p450 52..511 CDD:365848 98/408 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.