DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a9 and CYP4F3

DIOPT Version :9

Sequence 1:NP_523748.2 Gene:Cyp6a9 / 36663 FlyBaseID:FBgn0013771 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_000887.2 Gene:CYP4F3 / 4051 HGNCID:2646 Length:520 Species:Homo sapiens


Alignment Length:431 Identity:118/431 - (27%)
Similarity:207/431 - (48%) Gaps:66/431 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 DRGFYHNTEDDPLSGQ-LFLLDGQKWKSMRSKLSYTFTSGKMK-YMFPTVVKVGHEFIEVFGQ-- 164
            |:.||...:  |..|. |.|..|:||...|..|:..|....:| ||     |:.:|.:.:...  
Human   121 DKVFYSFLK--PWLGDGLLLSAGEKWSRHRRMLTPAFHFNILKPYM-----KIFNESVNIMHAKW 178

  Fly   165 ---AMEKSPIVEVRDILARFTTDVIGTCAFGIECSSLKDPEAEF--RVMGRRAIFEQRHGPIGIA 224
               |.|.|..:::.:.::..|.|.:..|.|..: |..::..:|:  .::...|:..:||..| :.
Human   179 QLLASEGSARLDMFEHISLMTLDSLQKCVFSFD-SHCQEKPSEYIAAILELSALVTKRHQQI-LL 241

  Fly   225 FIN----------SFQNLARRLH--MKITLEEAEHFFLRIVRETVA-------FREKNNIRRNDF 270
            :|:          .|:...|.:|  ....::|.        |.|:.       .:.|...:..||
Human   242 YIDFLYYLTPDGQRFRRACRLVHDFTDAVIQER--------RRTLPSQGVDDFLQAKAKSKTLDF 298

  Fly   271 MDQLIDLKNSPLTKSESGESVNLTIEEMAAQAFVFFGAGFETSSTTMGFALYELAQHQDIQDRVR 335
            :|.|:      |:|.|.|:  .|:.|::.|:|..|...|.:|:::.:.:.||.||:|.:.|:|.|
Human   299 IDVLL------LSKDEDGK--KLSDEDIRAEADTFMFEGHDTTASGLSWVLYHLAKHPEYQERCR 355

  Fly   336 KECQEVI-GKYNGEITYESMKDMVYLDQVISETLRLYTVLPVLNRECLEDYEVP-GHPKYVIKKG 398
            :|.||:: .:...||.::.:..:.:|...|.|:|||:..:|.::|.|.:|..:| |.   ||.||
Human   356 QEVQELLKDREPKEIEWDDLAQLPFLTMCIKESLRLHPPVPAVSRCCTQDIVLPDGR---VIPKG 417

  Fly   399 MPVLIPCGAMHRDEKLYANPNTFNPDNFSPERVKERDSVEWLPFGDGPRNCIGMRF--GQMQARS 461
            :..||.....|.:..::.:|..::|..|.|:.:|||..:.::||..|||||||..|  .:|:...
Human   418 IICLISVFGTHHNPAVWPDPEVYDPFRFDPKNIKERSPLAFIPFSAGPRNCIGQAFAMAEMKVVL 482

  Fly   462 GLALLINRFKFSVCEQTTIPIVYSKKTFLISSETGIFLKVE 502
            ||.||    :|.|....|.|  ..|...::.:|.|::|:||
Human   483 GLTLL----RFRVLPDHTEP--RRKPELVLRAEGGLWLRVE 517

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a9NP_523748.2 p450 35..499 CDD:278495 115/426 (27%)
CYP4F3NP_000887.2 p450 52..515 CDD:365848 115/427 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.