DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a9 and cyp4t8

DIOPT Version :9

Sequence 1:NP_523748.2 Gene:Cyp6a9 / 36663 FlyBaseID:FBgn0013771 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_954686.2 Gene:cyp4t8 / 387527 ZFINID:ZDB-GENE-031219-3 Length:509 Species:Danio rerio


Alignment Length:559 Identity:131/559 - (23%)
Similarity:222/559 - (39%) Gaps:125/559 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VYSVLLAIVVVLVGYLLLKWRRALHYWQNLDIPCEEPHILMGSLTGV-QTSRSFSAI--WMDYYN 64
            |::::....::.|..||:..|:.:...:.  .|....|.|.|.:... |.......|  ||:.|.
Zfish    16 VFALIFLACLLTVVKLLIVRRKGVKTMER--FPGPPAHWLFGHVKEFRQDGHDLEKIVKWMELYQ 78

  Fly    65 KFRGTGPFAGFYWFQRPGILVLDI---SLAKLILIKEFNKFTDRGFYHNTEDDP----------- 115
                   ||...|| .|.:.||:|   |..|.||               |..:|           
Zfish    79 -------FAFPLWF-GPSLAVLNIHHPSYVKTIL---------------TTTEPKDDYAYKFFIP 120

  Fly   116 -LSGQLFLLDGQKWKSMRSKLSYTFTSGKMKYMFPTV------VKVGHEFIEVFGQAMEKSPIVE 173
             |...|.:..||||...|..|:..|....:|   |.|      .||..:..||..::.|.   .|
Zfish   121 WLGDGLLVSTGQKWFRHRRLLTPGFHYDVLK---PYVKLISDSTKVMLDKWEVHSRSEES---FE 179

  Fly   174 VRDILARFTTDVIGTCAFGIECSSLKDPEAEFRVMGRRAIFEQRHGPIGIAFINSFQNLARRL-- 236
            :...::..|.|.|..|||....:...|......:   :|:|:..|          ..||..|:  
Zfish   180 LFKHVSLMTLDSIMKCAFSCNSNCQTDSGTNPYI---QAVFDLCH----------LVNLRFRVFP 231

  Fly   237 -HMKITLEEAEHFF----------------LRIVRETVAFREKNNIRRN----DFMDQLIDLKNS 280
             |.|.....:.|.:                :|..:|.:...|:..|.:|    ||:|.|:..:: 
Zfish   232 YHSKAIFHLSPHGYRFRKAASIAHNHTAEVIRKRKEVLKMEEEQGIVKNRRYLDFLDILLSARD- 295

  Fly   281 PLTKSESGESVNLTIEEMAAQAFVFFGAGFETSSTTMGFALYELAQHQDIQDRVRKECQEVI-GK 344
               :.:.|    |:.|::.|:...|...|.:|:::.:.:..|.||.:.:.|::.|:|.|:.: ||
Zfish   296 ---EHQQG----LSDEDIRAEVDTFMFEGHDTTASGISWIFYNLACNPEHQEKCRQEIQQALDGK 353

  Fly   345 YNGEITYESMKDMVYLDQVISETLRLYTVLPVLNREC------LEDYEVPGHPKYVIKKGMPVLI 403
              ..:.:|.:..:.|....|.|:|||:..:|.::|:.      .:...||        :|..:.:
Zfish   354 --ATLEWEDLNKIPYTTMCIKESLRLHPPVPGISRKLTKPLTFFDGRTVP--------EGCTIGV 408

  Fly   404 PCGAMHRDEKLYANPNTFNPDNFSPERVKERDSVEWLPFGDGPRNCIGMRFGQMQARSGLALLIN 468
            ....:|.:..::.||..|:|..|.||.|..|....::||..|||||||..|...:.:..:||.:.
Zfish   409 SIYGIHMNSTVWENPYKFDPLRFLPENVANRSPHAFVPFSAGPRNCIGQNFAMNEMKVAVALTLK 473

  Fly   469 RFKFSVCEQTT---IPIVYSKKTFLISSETGIFLKVERV 504
            |:........|   ||.|      ::.|..||.:|::.|
Zfish   474 RYYLIKDPDHTPKMIPQV------VLRSLNGIHIKIKPV 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a9NP_523748.2 p450 35..499 CDD:278495 124/520 (24%)
cyp4t8NP_954686.2 p450 46..501 CDD:306555 124/520 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.