DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a9 and CYP705A28

DIOPT Version :9

Sequence 1:NP_523748.2 Gene:Cyp6a9 / 36663 FlyBaseID:FBgn0013771 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_001154631.1 Gene:CYP705A28 / 3768880 AraportID:AT3G20935 Length:348 Species:Arabidopsis thaliana


Alignment Length:322 Identity:76/322 - (23%)
Similarity:139/322 - (43%) Gaps:59/322 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 GIECSSLKDPEAEFRVMGRRAIFEQR------------HGPIGIAFINSFQNLARRLHMKITLEE 244
            |..||. |:.||| ||.|  .:.|..            |.|:....|:.||...:.:..|.. |.
plant     4 GRSCSE-KNGEAE-RVRG--LVIESLALSPKIFLGMIFHKPLKKLGISLFQKDIKSVSPKFD-EL 63

  Fly   245 AEHFFLRIVRETVAFREKNNIRRNDFMDQLIDLKNSPLTKSESGESVNLTIEEM----AAQAFVF 305
            .|.|.:    |.....|:::.:.||.||.|::.....:      ::|||.|:.:    |.:..:.
plant    64 LEKFLV----EHEEKMEEDHYKANDMMDLLLEAMEMRM------QNVNLCIKRVSNTKARKPPIL 118

  Fly   306 FG----------------AGFETSSTTMGFALYELAQHQDIQDRVRKECQEVIGKYNGEITYES- 353
            |.                ||.:||:....:.:.||..:..|.:|:|:|.:.|:|  |..:..|: 
plant   119 FRYGKYSNNSLLLQELLVAGTDTSALATQWTMAELINNPTILERLREEIESVVG--NTRLIQETD 181

  Fly   354 MKDMVYLDQVISETLRLYTVLPVLNRECLEDYEVPGHPKYVIKKGMPVLIPCGAMHRDEKLYANP 418
            :.::.||..|:.|.|||:....:..|...|..|:.|.  |:.:|.: :::...|:.||...:.:|
plant   182 LSNLPYLQSVVKEGLRLHPPASISVRMSQERCELGGF--YIPEKTL-LVVNTYAIMRDPNFWEDP 243

  Fly   419 NTFNPDNF-SPERVKERDS-----VEWLPFGDGPRNCIGMRFGQMQARSGLALLINRFKFSV 474
            ..|.|:.| :..|.::.|.     ::::||..|.|.|.|.....:.....:.:::..|.:.:
plant   244 EEFKPERFITSSRSEQEDEMREEVLKYIPFSAGRRGCPGSNLAYVSLGIAIGVMVQCFDWRI 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a9NP_523748.2 p450 35..499 CDD:278495 76/322 (24%)
CYP705A28NP_001154631.1 p450 <13..346 CDD:299894 72/312 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D467733at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.