DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a9 and Cyp4e2

DIOPT Version :9

Sequence 1:NP_523748.2 Gene:Cyp6a9 / 36663 FlyBaseID:FBgn0013771 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_001286196.1 Gene:Cyp4e2 / 35822 FlyBaseID:FBgn0014469 Length:526 Species:Drosophila melanogaster


Alignment Length:570 Identity:127/570 - (22%)
Similarity:226/570 - (39%) Gaps:120/570 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VYSVLLAIVVVLVGYLLLKWRRALHYWQNLDIPCEEPHILMGSL--TGVQTSRSFSAI--WMDYY 63
            |..:.||:.::||.||.|...|........:.|...|  |||:.  .|...|.....:  |...|
  Fly     4 VLYIFLALPLLLVAYLELSTFRRRRVLNKFNGPRGLP--LMGNAHQMGKNPSEILDTVFSWWHQY 66

  Fly    64 NKFRGTGPFAGFYWF-QRPGILVLDISLAKLILIKEFNKFTDRGFYHNTEDDPLSG-QLFLLDGQ 126
            .|....      :|. ....:||......:.||..: ...|....|..|.  |..| .|....|.
  Fly    67 GKDNFV------FWIGTYSNVLVTSSKYLEFILSSQ-TLITKSDIYQLTH--PWLGLGLLTSTGS 122

  Fly   127 KWKSMRSKLSYTFTSGKMKYMFPTVVKVGHEFIEVFGQAMEKSPIVEVRDILARFTTDVIGTCAF 191
            ||...|..::..|....::.....:.:...:||:..........|.:.::.....|.|||...|.
  Fly   123 KWHKHRKMITPAFHFNILQDFHEVMNENSTKFIKHLKTVAAGDNIFDFQEQAHYLTLDVICDTAM 187

  Fly   192 GIECSSLKDPEAEFRVMGRRAIFEQRHGPIGIAFINSFQNLARRLHMKI---------------- 240
            |:..:::                |.|...|    :.:|:::...::|:.                
  Fly   188 GVSINAM----------------ENRSSSI----VQAFKDMCYNINMRAFHPLKRNELLYRLAPD 232

  Fly   241 ------TLEEAEHFFLRIVRETVAFREKNNIRRN----------DFMDQLID--LKNSPLTKSES 287
                  ||:..:.|...|:.:.:...:...:..|          .|:|.|:.  :...||...|.
  Fly   233 YPAYSRTLKTLQDFTNEIIAKRIEAHKSGAVSTNAGDEFTRKKMAFLDTLLSSTIDGRPLNSKEL 297

  Fly   288 GESVNLTIEEMAAQAFVFFGAGFETSSTTMGFALYELAQHQDIQDRVRKECQEVIGKYNGEI--- 349
            .|.|:         .|:|  .|.:|:::.:.||:|.|::|||.|.::.||.:||:|  |.|:   
  Fly   298 YEEVS---------TFMF--EGHDTTTSGVSFAVYLLSRHQDEQRKLFKEQREVMG--NSELGRD 349

  Fly   350 -TYESMKDMVYLDQVISETLRLYTVLPVLNRECLEDYEVPGHPKYVIKKGMPVLIPCGAMHRDEK 413
             |::.:..|.|||..|.|..|:|..:|.:.|...:||.:.|.   ::.||..:.:....:..:||
  Fly   350 ATFQEISQMKYLDLFIKEAQRVYPSVPFIGRFTEKDYVIDGD---LVPKGTTLNLGLVMLGYNEK 411

  Fly   414 LYANPNTFNPDNFSPERVKERDSVEWLPFGDGPRNCIGMRFGQMQARSGLALLINRFKF--SVCE 476
            ::.:|:.|.|:.|..|:   ....|::||..|||||||.:|..::.::.::.:|..|:.  ::.|
  Fly   412 VFKDPHKFRPERFELEK---PGPFEYVPFSAGPRNCIGQKFALLEIKTVVSKIIRNFEVLPALDE 473

  Fly   477 --------QTTI--PIVYSKK--------------TFLISSETGIFLKVE 502
                    .|||  |....||              ...:.||.|::::::
  Fly   474 LVSKDGYISTTIGLPDAERKKRDPYRHKYDPILSAVLTLKSENGLYIRLK 523

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a9NP_523748.2 p450 35..499 CDD:278495 118/533 (22%)
Cyp4e2NP_001286196.1 p450 35..469 CDD:278495 108/483 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.