DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a9 and Cyp4f39

DIOPT Version :9

Sequence 1:NP_523748.2 Gene:Cyp6a9 / 36663 FlyBaseID:FBgn0013771 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_796281.1 Gene:Cyp4f39 / 320997 MGIID:2445210 Length:532 Species:Mus musculus


Alignment Length:572 Identity:127/572 - (22%)
Similarity:233/572 - (40%) Gaps:140/572 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VYSVLLAIVVVLVGYLLLKWRRALHYWQNLDIPCE------EP---HILMGSLT-------GVQ- 50
            |.|.||.:|:.....||:   ||...:.:..|.|.      ||   |.|:|.::       |:| 
Mouse    23 VVSALLLLVLFFFFRLLV---RAFKLFSDFRITCRKLSCFPEPPGRHWLLGHMSMYLPNEKGLQN 84

  Fly    51 ------TSRSFSAIWMDYYNKFRGTGPFAGFYWFQRPGILVLDISLAKLILIKEFNKFTDRGFYH 109
                  |.......|:         |||........|..:...:..:..|..|:       .|::
Mouse    85 EKKVLDTMHHIILAWV---------GPFLPLLVLVHPDYIKPVLGASAAIAPKD-------EFFY 133

  Fly   110 NTEDDPLSGQLFLLDGQKWKSMRSKLSYTFTSGKMKYMFPTVVKVGHEFIEVFGQA--------- 165
            :.....|...|.:..|.||...|..|:..|....:|           .::::|.|.         
Mouse   134 SFLKPWLGDGLLISKGNKWSRHRRLLTPAFHFDILK-----------PYMKIFNQCTNIMHAKWR 187

  Fly   166 --MEKSPIV--EVRDILARFTTDVIGTCAFGI--ECSS-LKDPEAEFRVMGRRAIFEQRHGPIGI 223
              :.:..:.  ::.:.::..|.|.:..|.|..  :|.. :.|                       
Mouse   188 RHLAEGSVTSFDMFEHISLMTLDSLQKCVFSYNSDCQERMSD----------------------- 229

  Fly   224 AFINSFQNLAR-------RLH---------------MKITLEEAEHFFLRIVRE---------TV 257
             :|:|...|:.       |||               .:...:...:|...:::|         ..
Mouse   230 -YISSIIELSALVVRRQYRLHHYLDFMYYLTADGRRFRQACDTVHNFTTEVIQERRQALRQQGAE 293

  Fly   258 AFREKNNIRRNDFMDQLIDLKNSPLTKSESGESVNLTIEEMAAQAFVFFGAGFETSSTTMGFALY 322
            |:.:....:..||:|.|:      |.|.|.|:  .|:.|::.|:|..|...|.:|:|:.:.:||:
Mouse   294 AWLKAKQGKTLDFIDVLL------LAKDEEGK--ELSDEDIRAEADTFMFEGHDTTSSGLSWALF 350

  Fly   323 ELAQHQDIQDRVRKECQEVI-GKYNGEITYESMKDMVYLDQVISETLRLYTVLPVLNRECLEDYE 386
            .||::.:.|::.|:|.|||: |:...|:.::.:..:.:....|.|:||.:..:.:::|.|.||.:
Mouse   351 NLAKYPEYQEKCREEIQEVMKGRELEELDWDDLTQLPFTTMCIKESLRQFPPVTLISRRCTEDIK 415

  Fly   387 VP-GHPKYVIKKGMPVLIPCGAMHRDEKLYANPNTFNPDNFSPERVKERDSVEWLPFGDGPRNCI 450
            :| |.   ||.||:..|:.....|.:..::.:...:||..|.|:..::|..:.::||..||||||
Mouse   416 LPDGR---VIPKGIICLVSIYGTHHNPIVWPDSKVYNPYRFDPDTPQQRSPLAFVPFSAGPRNCI 477

  Fly   451 GMRFGQMQARSGLALLINRFKFSVCEQTTIPIVYSKKTFLISSETGIFLKVE 502
            |..|...:.|..:||.:.||:.|| ::|  ..|..|...::.:|.|::|.||
Mouse   478 GQSFAMAEMRVVVALTLLRFRLSV-DRT--HKVRRKPELILRTENGLWLNVE 526

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a9NP_523748.2 p450 35..499 CDD:278495 114/535 (21%)
Cyp4f39NP_796281.1 p450 60..515 CDD:365848 111/519 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.