DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a9 and Cyp4a3

DIOPT Version :9

Sequence 1:NP_523748.2 Gene:Cyp6a9 / 36663 FlyBaseID:FBgn0013771 Length:504 Species:Drosophila melanogaster
Sequence 2:XP_038965516.1 Gene:Cyp4a3 / 298423 RGDID:631356 Length:511 Species:Rattus norvegicus


Alignment Length:537 Identity:142/537 - (26%)
Similarity:237/537 - (44%) Gaps:89/537 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLAIVVVLVG----YLLLKW-RRALHYWQNLDIPCEEPHILMGSLTGVQTSRSFSAI--WMDYYN 64
            ||::.:||..    ||..:| .:||.     ..|....|.|.|.   ....|.|..:  |::   
  Rat    24 LLSLFLVLFKAVQFYLRRQWLLKALE-----KFPSTPSHWLWGH---DLKDREFQQVLTWVE--- 77

  Fly    65 KFRGTGPFAGFYWF--QRPGILVLDISLAKLILIKEFNKFTDRGFYHNTEDDPLSGQ---LFLLD 124
            ||    |.|...|.  .:..:|:.|....|::|.:...|.:  |.|.......:||.   |.||:
  Rat    78 KF----PGACLQWLSGSKTRVLLYDPDYVKVVLGRSDPKAS--GIYQFLAPWIVSGTGYGLLLLN 136

  Fly   125 GQKWKSMRSKLSYTFTSGKMKYMFPTVVKVGHEFIEVFGQAMEK-----SPIVEVRDILARFTTD 184
            |:||......|:..|..|.:|    ..||:..:.:.:.....||     .|: |:...::..|.|
  Rat   137 GKKWFQHWRMLTPAFHYGILK----PYVKIMADSVSIMLDKWEKLDDQDHPL-EIFHYVSLMTLD 196

  Fly   185 VIGTCAFGIECSSLKDPEAE--------------FRVMGRRAIFEQRHGPIGIAFINSFQNLARR 235
            .:..|||..:.|...|..:.              |||   |:.|   :|...|..::|...|:||
  Rat   197 TVMKCAFSHQGSVQLDVNSRSYTKAVEDLNNLTFFRV---RSAF---YGNSIIYNMSSDGRLSRR 255

  Fly   236 L------HMK--ITLEEAEHFFLRIVRETVAFREKNNIRRNDFMDQLIDLKNSPLTKSESGESVN 292
            .      |..  |.:.:|:   |:...|....|:|.::   ||:|.|:      ..|.|.|:|  
  Rat   256 ACQIAHEHTDGVIKMRKAQ---LQNEEELQKARKKRHL---DFLDILL------FAKMEDGKS-- 306

  Fly   293 LTIEEMAAQAFVFFGAGFETSSTTMGFALYELAQHQDIQDRVRKECQEVIGKYNGEITYESMKDM 357
            |:.|::.|:...|...|.:|:::.:.:..|.||.|.:.|:|.|:|.|.::|. ...:|::.:..:
  Rat   307 LSDEDLRAEVDTFMFEGHDTTASGISWVFYALATHPEHQERCREEVQSILGD-GTSVTWDHLDQI 370

  Fly   358 VYLDQVISETLRLYTVLPVLNRECLEDYEVPGHPKYVIKKGMPVLIPCGAMHRDEKLYANPNTFN 422
            .|....|.|.||||..:|.::||.......|....  |.||:...|....:|.:...:.||..|:
  Rat   371 SYTTMCIKEALRLYPPVPSVSRELSSPVTFPDGRS--IPKGITTTILIYGLHHNPSYWPNPKVFD 433

  Fly   423 PDNFSPERVKERDSVEWLPFGDGPRNCIGMRFGQMQARSGLALLINRFKFSVCEQTTIPIVYSKK 487
            |..|||:  ..|.|..:|||..|.|||||.:|...:.:..:||.:.||:. :.:.|.||:..:: 
  Rat   434 PSRFSPD--SPRHSHAYLPFSGGARNCIGKQFAMNELKVAVALTLLRFEL-LPDPTRIPVPMAR- 494

  Fly   488 TFLISSETGIFLKVERV 504
             .::.|:.||.|:::::
  Rat   495 -LVLKSKNGIHLRLKKL 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a9NP_523748.2 p450 35..499 CDD:278495 132/497 (27%)
Cyp4a3XP_038965516.1 CYP4B-like 69..506 CDD:410771 127/478 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.