DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a9 and Cyp4f18

DIOPT Version :9

Sequence 1:NP_523748.2 Gene:Cyp6a9 / 36663 FlyBaseID:FBgn0013771 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_001028858.2 Gene:Cyp4f18 / 290623 RGDID:1305261 Length:524 Species:Rattus norvegicus


Alignment Length:495 Identity:122/495 - (24%)
Similarity:225/495 - (45%) Gaps:77/495 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 EEPHILMGSLTGVQTSRSFSAIWMDYYNKFRGTGPFAGFYWFQRPGILVLDISLAKLILIKEFNK 101
            ||..:.:.||:  :|.|.....|:         ||     |  .|.|.:...:..|.:::...:.
  Rat    71 EEGLLYIQSLS--RTFRDVCCWWV---------GP-----W--HPVIRIFHPAFIKPVILAPASV 117

  Fly   102 F-TDRGFYHNTEDDPLSGQ-LFLLDGQKWKSMRSKLSYTFTSGKMKYMFPTVVKVGHEFIEVFGQ 164
            . .||.||...:  |..|. |.|..|.||...|..|:..|....:|           .::::|..
  Rat   118 APKDRVFYRFLK--PWLGDGLLLSTGDKWSRHRHMLTPAFHFNILK-----------PYVKIFND 169

  Fly   165 ------------AMEKSPIVEVRDILARFTTDVIGTCAFGIECSSLKDPEAEF--RVMGRRAIFE 215
                        |.:.|..:::.:.::..|.|.:..|.|..: |:.::..:|:  .::...|:..
  Rat   170 STNIMHAKWQRLASQGSARLDMFEHISLMTLDSLQKCVFSFD-SNCQEKPSEYITAILELSALVA 233

  Fly   216 QRHGPIGIAFINSFQNLAR-RLHMKITLEEAEHFFLRIVRE---TV-------AFREKNNIRRND 269
            :||..: :.:::.|.:|.| .:..:........|...::||   |:       |.:.|...:..|
  Rat   234 RRHQSL-LLYVDLFYHLTRDGMRFRKACRLVHDFTDAVIRERRRTLPDQGGDDALKAKAKAKTLD 297

  Fly   270 FMDQLIDLKNSPLTKSESGESVNLTIEEMAAQAFVFFGAGFETSSTTMGFALYELAQHQDIQDRV 334
            |:|.|:      |:|.|.||:  |:.|::.|:|..|...|.:|:::.:.:.||.||:|.:.|:|.
  Rat   298 FIDVLL------LSKDEHGEA--LSDEDIRAEADTFMFGGHDTTASGLSWILYNLAKHPEYQERC 354

  Fly   335 RKECQEVI-GKYNGEITYESMKDMVYLDQVISETLRLYTVLPVLNRECLEDYEVP-GHPKYVIKK 397
            |:|.:|:: .:...||.::.:..:.:|...|.|:|||:.....::|.|.:|..:| |.   ||.|
  Rat   355 RQEVRELLRDREPEEIEWDDLAQLPFLTMCIKESLRLHPPATAISRCCTQDIMLPDGR---VIPK 416

  Fly   398 GMPVLIPCGAMHRDEKLYANPNTFNPDNFSPERVKERDSVEWLPFGDGPRNCIGMRFGQMQARSG 462
            |:...|.....|.:..::.:|..:||..|..:..:.|..:.::||..|||||||..|...:.:..
  Rat   417 GVICRISIFGTHHNPAVWPDPEVYNPFRFDADNGEGRSPLAFIPFSAGPRNCIGQTFAMSEMKVA 481

  Fly   463 LALLINRFKFSVCEQTTIPIVYSKKTFLISSETGIFLKVE 502
            |||.:.||:  |......|  ..|...::.:|.|::|:||
  Rat   482 LALTLLRFR--VLPDDKEP--RRKPELILRAEGGLWLRVE 517

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a9NP_523748.2 p450 35..499 CDD:278495 119/490 (24%)
Cyp4f18NP_001028858.2 CYP4F 74..515 CDD:410772 117/488 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.