DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a9 and CYP4X1

DIOPT Version :9

Sequence 1:NP_523748.2 Gene:Cyp6a9 / 36663 FlyBaseID:FBgn0013771 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_828847.1 Gene:CYP4X1 / 260293 HGNCID:20244 Length:509 Species:Homo sapiens


Alignment Length:563 Identity:133/563 - (23%)
Similarity:229/563 - (40%) Gaps:136/563 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VYSVLLAIVVVLVGYL----LLKWRRALHYWQNLDIPCEEPHILMGSLTGVQTS----------- 52
            |:.:.|.::..:..||    ||:..|        ..|....|..:|....:|..           
Human    19 VFCLALGLLQAIKLYLRRQRLLRDLR--------PFPAPPTHWFLGHQKFIQDDNMEKLEEIIEK 75

  Fly    53 --RSFSAIWMDYYNKFRGTGPFAGFYWFQRPGILVLDISLAKLILIKEFNKFTD-RGFYHNTEDD 114
              |:| ..|:         |||..|:       .:.|...||.:|.:     || :..|......
Human    76 YPRAF-PFWI---------GPFQAFF-------CIYDPDYAKTLLSR-----TDPKSQYLQKFSP 118

  Fly   115 PLSGQ-LFLLDGQKWKSMRSKLSYTFTSGKMKYMFPTVVKVGHEFIEVFGQAME----------- 167
            ||.|: |..|||.||...|..|:..|....:|           .:|||...:::           
Human   119 PLLGKGLAALDGPKWFQHRRLLTPGFHFNILK-----------AYIEVMAHSVKMMLDKWEKICS 172

  Fly   168 -KSPIVEVRDILARFTTDVIGTCAFGIE--C--SSLKDPEAEFRVMGRRAIFEQ----------- 216
             :...|||.:.:...:.|:|..|||..|  |  :|..||.|       :||||.           
Human   173 TQDTSVEVYEHINSMSLDIIMKCAFSKETNCQTNSTHDPYA-------KAIFELSKIIFHRLYSL 230

  Fly   217 --------RHGPIGIAFINSFQNLARRLHMKITLEEAEHFFLRIVRE-----TVAFREKNNIRR- 267
                    :..|.|.    .||.|:|.|:         .:...|::|     ....::.|..:| 
Human   231 LYHSDIIFKLSPQGY----RFQKLSRVLN---------QYTDTIIQERKKSLQAGVKQDNTPKRK 282

  Fly   268 -NDFMDQLIDLKNSPLTKSESGESVNLTIEEMAAQAFVFFGAGFETSSTTMGFALYELAQHQDIQ 331
             .||:|.::.      .|.|||.|  .:..::.::...|..||.:|.:.::.:.||.||.:.:.|
Human   283 YQDFLDIVLS------AKDESGSS--FSDIDVHSEVSTFLLAGHDTLAASISWILYCLALNPEHQ 339

  Fly   332 DRVRKECQEVIGKYNGEITYESMKDMVYLDQVISETLRLYTVLPVLNRECLEDYEVPGHPKYVIK 396
            :|.|:|.:.::|. ...||::.:.:|.|....|.||.||...:|.::|:..:....|  ....:.
Human   340 ERCREEVRGILGD-GSSITWDQLGEMSYTTMCIKETCRLIPAVPSISRDLSKPLTFP--DGCTLP 401

  Fly   397 KGMPVLIPCGAMHRDEKLYANPNTFNPDNFSPERVKERDSVEWLPFGDGPRNCIGMRFGQMQARS 461
            .|:.|::....:|.:..::.||..|:|..||.|...:|....:|||..|.|||||..|..::.:.
Human   402 AGITVVLSIWGLHHNPAVWKNPKVFDPLRFSQENSDQRHPYAYLPFSAGSRNCIGQEFAMIELKV 466

  Fly   462 GLALLINRFKFSVCEQTTIPIVYSKKTFLISSETGIFLKVERV 504
            .:||::..|:  |....|.|:.:... |::..:.|::|.::::
Human   467 TIALILLHFR--VTPDPTRPLTFPNH-FILKPKNGMYLHLKKL 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a9NP_523748.2 p450 35..499 CDD:278495 125/520 (24%)
CYP4X1NP_828847.1 p450 47..501 CDD:306555 125/520 (24%)
heme binding region 447..460 7/12 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.