DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a9 and Cyp4b1

DIOPT Version :9

Sequence 1:NP_523748.2 Gene:Cyp6a9 / 36663 FlyBaseID:FBgn0013771 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_058695.2 Gene:Cyp4b1 / 24307 RGDID:2480 Length:511 Species:Rattus norvegicus


Alignment Length:554 Identity:135/554 - (24%)
Similarity:228/554 - (41%) Gaps:121/554 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGVY-SVLLAIVVVLVGYLLL----KWRRALHYWQNLDIPCEEPHILMGSLTGVQTSRSFSAI-- 58
            :|:: ||::.:|:||..:.||    |..||:.     ..|....|.|.|....:|...|...:  
  Rat    13 LGLWASVVILMVIVLKLFSLLLRRQKLARAMD-----SFPGPPTHWLFGHALEIQKLGSLDKVVS 72

  Fly    59 WMDYYNKFRGTGPFAGFYWF-QRPGIL-VLDISLAKLILIKEFNKFTDRGFYHNTEDDPLSGQ-- 119
            |...:       |.|...|| |..|.| :.:...||.:.        .||       ||.:..  
  Rat    73 WAQQF-------PHAHPLWFGQFVGFLNIYEPDYAKAVY--------SRG-------DPKAADVY 115

  Fly   120 ----------LFLLDGQKWKSMRSKLSYTFTSGKMKYMFPTVVKVGHEFIEVFGQAM-------- 166
                      |.:|||.||...|..|:..|....:|           .::.:|.::.        
  Rat   116 DFFLQWIGKGLLVLDGPKWFQHRKLLTPGFHYDVLK-----------PYVAIFAESTRMMLDKWE 169

  Fly   167 EKSPIVEVRDI---LARFTTDVIGTCAFGIECSSL--KDPEAEFRVMGRRAIFEQRHGPIGIAFI 226
            :|:...:..||   :.....|.:..|.||...|.|  :|......|.....:.:||        |
  Rat   170 KKASENKSFDIFCDVGHMALDTLMKCTFGKGDSGLGHRDNSYYLAVSDLTLLMQQR--------I 226

  Fly   227 NSFQNLARRLHMKITLEEAEH--FFLR-----------IVRETVAF------REKNNIRRN-DFM 271
            :|||     .|.........|  .|||           ::|:..|.      |:|...||: ||:
  Rat   227 DSFQ-----YHNDFIYWLTPHGRRFLRACKIAHDHTDEVIRQRKAALQDEKERKKIQQRRHLDFL 286

  Fly   272 DQLIDLKNSPLTKSESGESVNLTIEEMAAQAFVFFGAGFETSSTTMGFALYELAQHQDIQDRVRK 336
            |.|:.:::      |||  :.|:..|:.|:...|...|.:|:::.:.:.||.:|.:.:.|...|:
  Rat   287 DILLGVRD------ESG--IKLSDAELRAEVDTFMFEGHDTTTSGISWFLYCMALYPEHQQLCRE 343

  Fly   337 ECQEVIGKYNGEITYESMKDMVYLDQVISETLRLYTVLPVLNRECLEDYE-VPGHPKYVIKKGMP 400
            |.:.::|..: ...::.:..|.||...:.|..|||..:|.:.|:..:... |.|..   :..|..
  Rat   344 EVRGILGDQD-SFQWDDLAKMTYLTMCMKECFRLYPPVPQVYRQLNKPVTFVDGRS---LPAGSL 404

  Fly   401 VLIPCGAMHRDEKLYANPNTFNPDNFSPERVKERDSVEWLPFGDGPRNCIGMRFGQMQARSGLAL 465
            :.:...|:||:..::.:|..|:|..||||....|....::||..|||||||.:|...:.:...||
  Rat   405 ISLHIYALHRNSTVWPDPEVFDPLRFSPENAAGRHPFAFMPFSAGPRNCIGQQFAMNEMKVVTAL 469

  Fly   466 LINRFKFSVCEQTTIPIVYSKKTFLISSETGIFL 499
            .:.||:||: :.:.:||...:  .::.|:.||.|
  Rat   470 CLLRFEFSL-DPSKMPIKVPQ--LILRSKNGIHL 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a9NP_523748.2 p450 35..499 CDD:278495 123/513 (24%)
Cyp4b1NP_058695.2 p450 47..500 CDD:278495 123/513 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.