DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a9 and CYP4Z1

DIOPT Version :9

Sequence 1:NP_523748.2 Gene:Cyp6a9 / 36663 FlyBaseID:FBgn0013771 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_835235.1 Gene:CYP4Z1 / 199974 HGNCID:20583 Length:505 Species:Homo sapiens


Alignment Length:527 Identity:132/527 - (25%)
Similarity:221/527 - (41%) Gaps:72/527 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SVLLAIVVVLVGYLLLKWR-RALHYWQNLDIPCEEPHILMGSLTGVQTSRSFSAI-WMDYYNKFR 67
            |:||..|:.|  |...:|. ||||.:     |....|...|       .:.|..: ..:.|:|..
Human    23 SLLLFQVIRL--YQRRRWMIRALHLF-----PAPPAHWFYG-------HKEFYPVKEFEVYHKLM 73

  Fly    68 ---------GTGPFAGFYWFQRPGILVLDISLAKLILIKEFNKFTDRGFYHNTEDDPLSGQLFLL 123
                     ..|||..|:       .|.|...||::|.::..|   ....|...:..:...|..|
Human    74 EKYPCAVPLWVGPFTMFF-------SVHDPDYAKILLKRQDPK---SAVSHKILESWVGRGLVTL 128

  Fly   124 DGQKWKSMRSKLSYTFTSGKMKYMFPTVVKVGHEFIEVFGQAMEKSPIVEVRDILARFTTDVIGT 188
            ||.|||..|..:...|....:|.....:.:.....:..:.:.:.::..:|:...::..|.|.|..
Human   129 DGSKWKKHRQIVKPGFNISILKIFITMMSESVRMMLNKWEEHIAQNSRLELFQHVSLMTLDSIMK 193

  Fly   189 CAF----GIECSSLKDPEAEFRVMGRRAIFEQR------HGPIGIAFINS---FQNLARRLHM-- 238
            |||    .|:..|..|...: .|.....|..||      |..:...|.:.   |....:.||.  
Human   194 CAFSHQGSIQLDSTLDSYLK-AVFNLSKISNQRMNNFLHHNDLVFKFSSQGQIFSKFNQELHQFT 257

  Fly   239 -KITLEEAEHFFLRIVRETVAFREKNNIRRNDFMDQLIDLKNSPLTKSESGESVNLTIEEMAAQA 302
             |:..:..|....::.::|.   :|   ||.||:|.|:..|        |..:.:.:..::.|:.
Human   258 EKVIQDRKESLKDKLKQDTT---QK---RRWDFLDILLSAK--------SENTKDFSEADLQAEV 308

  Fly   303 FVFFGAGFETSSTTMGFALYELAQHQDIQDRVRKECQEVIGKYNGEITYESMKDMVYLDQVISET 367
            ..|..||.:|:|:.:.:.||.||::.:.|.|.|.|.:|::|. ...||:|.:..|.|....|.|.
Human   309 KTFMFAGHDTTSSAISWILYCLAKYPEHQQRCRDEIRELLGD-GSSITWEHLSQMPYTTMCIKEC 372

  Fly   368 LRLYTVLPVLNRECLEDYEVPGHPKYVIKKGMPVLIPCGAMHRDEKLYANPNTFNPDNFSPERVK 432
            ||||.  ||:|...|.|..:.......:..|:.|.|...|:|.:...:.:|..|||..||.|..:
Human   373 LRLYA--PVVNISRLLDKPITFPDGRSLPAGITVFINIWALHHNPYFWEDPQVFNPLRFSRENSE 435

  Fly   433 ERDSVEWLPFGDGPRNCIGMRFGQMQARSGLALLINRFKFSVCEQTTIPIVYSKKTFLISSETGI 497
            :.....::||..|.|||||..|..::.:..:||.:.|||.:. :.:..|  ...:..::.|:.||
Human   436 KIHPYAFIPFSAGLRNCIGQHFAIIECKVAVALTLLRFKLAP-DHSRPP--QPVRQVVLKSKNGI 497

  Fly   498 FLKVERV 504
            .:..::|
Human   498 HVFAKKV 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a9NP_523748.2 p450 35..499 CDD:278495 120/489 (25%)
CYP4Z1NP_835235.1 p450 47..500 CDD:278495 120/490 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.