DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a9 and Cyp4f13

DIOPT Version :9

Sequence 1:NP_523748.2 Gene:Cyp6a9 / 36663 FlyBaseID:FBgn0013771 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_570952.1 Gene:Cyp4f13 / 170716 MGIID:2158641 Length:523 Species:Mus musculus


Alignment Length:408 Identity:97/408 - (23%)
Similarity:198/408 - (48%) Gaps:44/408 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 LSGQLFLLDGQKWKSMRSKLSYTFTSGKMKYMFPTVVKVGHEFIEVFGQ-----AMEKSPIVEVR 175
            |...|.:..|.||...|..|:..|....:|    :.||:.::.:.:...     |.:.:..:::.
Mouse   132 LGDGLLMSAGDKWSHHRRLLTPAFHFDILK----SYVKIFNKSVNIMHAKWQCLASKGTSRLDMF 192

  Fly   176 DILARFTTDVIGTCAFGIECSSLKDPEAEF--RVMGRRAIFEQRHGPIGIAFINSFQNL---ARR 235
            :.::..|.|.:..|.|.:: |:.::.::::  .::...::..:||.. ...:::....|   .||
Mouse   193 EHISLMTLDSLQKCIFSVD-SNCQESDSKYIAAILELSSLVVKRHRQ-PFLYLDLLYYLTADGRR 255

  Fly   236 LHMKITLEEAEHFFLRIVRET--------VAF-REKNNIRRNDFMDQLIDLKNSPLTKSESGESV 291
            ......|  ..:|...:::|.        |.| :.|...:..||:|.|:      :.:.|.|:  
Mouse   256 FRKACDL--VHNFTDAVIKERRSTLNTQGVEFLKAKAKTKTLDFIDVLL------MAEDEHGK-- 310

  Fly   292 NLTIEEMAAQAFVFFGAGFETSSTTMGFALYELAQHQDIQDRVRKECQEVI-GKYNGEITYESMK 355
            .|:.|::.|:|..|...|.:|:::.:.:.||.||:|.:.|:|.|:|.||:: .:.:.||.::.:.
Mouse   311 GLSNEDIRAEADTFMFGGHDTTTSALSWILYNLARHPEYQERCRQEVQELLRDRDSEEIEWDDLA 375

  Fly   356 DMVYLDQVISETLRLYTVLPVLNRECLEDYEVP-GHPKYVIKKGMPVLIPCGAMHRDEKLYANPN 419
            .:.:|...|.|:|||:..:.:::|.|.:|..:| |.   .|.||...:|....:|.:..::.:|.
Mouse   376 QLPFLTMCIKESLRLHPPVLLISRCCTQDVLLPDGR---AIPKGNICVISIFGVHHNPSVWPDPE 437

  Fly   420 TFNPDNFSPERVKERDSVEWLPFGDGPRNCIGMRFGQMQARSGLALLINRFKFSVCEQTTIPIVY 484
            .:||..|.||..::|..:.::||..|.|||||..|...:.:..|||.:.||:....::..    .
Mouse   438 VYNPFRFDPENPQKRSPLAFIPFSAGTRNCIGQTFAMSEIKVALALTLLRFRILPDDKEP----R 498

  Fly   485 SKKTFLISSETGIFLKVE 502
            .|...::.:|.|::|:||
Mouse   499 RKPELILRAEGGLWLRVE 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a9NP_523748.2 p450 35..499 CDD:278495 94/403 (23%)
Cyp4f13NP_570952.1 p450 52..513 CDD:278495 94/403 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.