DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a9 and Cyp4b1

DIOPT Version :9

Sequence 1:NP_523748.2 Gene:Cyp6a9 / 36663 FlyBaseID:FBgn0013771 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_031849.1 Gene:Cyp4b1 / 13120 MGIID:103225 Length:511 Species:Mus musculus


Alignment Length:555 Identity:126/555 - (22%)
Similarity:227/555 - (40%) Gaps:123/555 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGVYSVLLAIVVVLVGYLLLKWRRALHYWQNL-----DIPCEEPHILMGSLTGVQTSRSFSAI-- 58
            :|:::.::.::|.::..|.|.:||     |.|     ..|....|.|.|....:|.:.....:  
Mouse    13 LGLWASVVILMVTVLKLLSLLFRR-----QKLARALDSFPGPPKHWLFGHALEIQKTGGLDKVVT 72

  Fly    59 WMDYYNKFRGTGPFAGFYWFQRPGILVLDI---SLAKLILIKEFNKFTDRGFYHNTEDDP----- 115
            |.:.:       |:|...|..: .|:.|:|   ..||.:.        .||       ||     
Mouse    73 WTEQF-------PYAHPLWLGQ-FIVFLNIYEPDYAKAVY--------SRG-------DPKAAYV 114

  Fly   116 -------LSGQLFLLDGQKWKSMRSKLSYTFTSGKMKYMFPTVVKVGHEFIEVFGQAM------- 166
                   :...|.:|:|.||...|..|:..|....:|           .::.:|.::.       
Mouse   115 YDFFLQWIGKGLLVLEGPKWFQHRKLLTPGFHYDVLK-----------PYVAIFAESTRVMLDKW 168

  Fly   167 -EKSPIVEVRDI---LARFTTDVIGTCAFGIECSSLKDPEAEF--------RVMGRRAIFEQRHG 219
             :|:...:..||   :.....|.:..|.||...|.|...:..:        .:|.:|....|.|.
Mouse   169 EKKASENKSFDIFCDVGHMALDTLMKCTFGKGDSGLSHSDNSYYLAVSDLTLLMQQRIDSFQYHN 233

  Fly   220 -------PIGIAFINSFQNLARRLHMKITLEEAEHFFLRIVRETVAF----REKNNI---RRNDF 270
                   |.|..|:.:.|         |..:..:|    ::|:..|.    :|:..:   |..||
Mouse   234 DFIYWLTPHGRRFLRACQ---------IAHDHTDH----VIRQRKAALQDEKEQKKLQERRHLDF 285

  Fly   271 MDQLIDLKNSPLTKSESGESVNLTIEEMAAQAFVFFGAGFETSSTTMGFALYELAQHQDIQDRVR 335
            :|.|:.      .:.|||  :.|:..::.|:...|...|.:|:::.:.:.||.:|.:...|.|.|
Mouse   286 LDILLG------ARDESG--IKLSDADLRAEVDTFMFEGHDTTTSGISWFLYCMALYPMHQQRCR 342

  Fly   336 KECQEVIGKYNGEITYESMKDMVYLDQVISETLRLYTVLPVLNRECLEDYE-VPGHPKYVIKKGM 399
            :|.:|::|. .....::.:..|.||...:.|..|||..:|.:.|:..:... |.|..   :..|.
Mouse   343 EEVREILGD-RDSFQWDDLAQMTYLTMCMKECFRLYPPVPQVYRQLSKPVTFVDGRS---LPAGS 403

  Fly   400 PVLIPCGAMHRDEKLYANPNTFNPDNFSPERVKERDSVEWLPFGDGPRNCIGMRFGQMQARSGLA 464
            .:.:...|:||:..::.:|..|:|..||||.:..|....::||..|||||||.:|...:.:...|
Mouse   404 LISLHIYALHRNSAVWPDPEVFDPLRFSPENMTGRHPFAFMPFSAGPRNCIGQQFAMNEMKVVTA 468

  Fly   465 LLINRFKFSVCEQTTIPIVYSKKTFLISSETGIFL 499
            |.:.||:||. :.:.|||...:  .::.|:.||.|
Mouse   469 LCLLRFEFSP-DPSKIPIKVPQ--LILRSKNGIHL 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a9NP_523748.2 p450 35..499 CDD:278495 117/514 (23%)
Cyp4b1NP_031849.1 p450 47..500 CDD:278495 117/514 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.