DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a9 and Cyp4f15

DIOPT Version :9

Sequence 1:NP_523748.2 Gene:Cyp6a9 / 36663 FlyBaseID:FBgn0013771 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_598888.1 Gene:Cyp4f15 / 106648 MGIID:2146921 Length:534 Species:Mus musculus


Alignment Length:473 Identity:122/473 - (25%)
Similarity:217/473 - (45%) Gaps:81/473 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 GPFAGFYWFQRPGILVLDISLAKLILIKE--FNKFTDRGFYHNTEDDPLSGQ-LFLLDGQKWKSM 131
            ||.........|.|:...::.:..:.:||  |..|.          .|..|. |.|.||.||.|.
Mouse    98 GPIIPIITLCHPDIIRSVLNASASVALKEVVFYSFL----------KPWLGDGLLLSDGDKWSSH 152

  Fly   132 RSKLSYTFTSGKMKYMFPTVVKVGHEFIEVFGQ------------AMEKSPIVEVRDILARFTTD 184
            |..|:..|....:|           .::::|..            |...|..::|.:.::..|.|
Mouse   153 RRMLTPAFHFNILK-----------PYVKIFNDSTNIMHAKWQHLASGGSARLDVFENISLMTLD 206

  Fly   185 VIGTCAFGIECSSLKDPEAEF--RVMGRRAIFEQRHGPIGIAFINSFQNL---ARRLHMKITLEE 244
            .:..|.|..:.:..::| :|:  .::...|:..:|:..: :..|:|...|   .||.|....|  
Mouse   207 SLQKCVFSFDSNCQENP-SEYISAILELSALVTKRYHQL-LLHIDSLYQLTCSGRRFHKACHL-- 267

  Fly   245 AEHFFLRIV----RETVAFREKNNI-------RRNDFMDQLIDLKNSPLTKSESGESVNLTIEEM 298
             .|.|...|    |.|:..:.::::       :..||:|.|:      |:|.|.|:  .|:.|::
Mouse   268 -VHSFTDAVIQDRRRTLPSKHEDDVLKAKAKSKTLDFIDVLL------LSKDEDGK--ELSDEDI 323

  Fly   299 AAQAFVFFGAGFETSSTTMGFALYELAQHQDIQDRVRKECQEVI-GKYNGEI-------TYESMK 355
            .|:|..|...|.:|:::.:.:.||.||:|.:.|:|.|:|.||:: .:.:.||       ..:.:.
Mouse   324 RAEADTFMFEGHDTTASGLSWILYNLARHPEYQERCRQEVQELLRDRESTEIECSCAVFLRDDLA 388

  Fly   356 DMVYLDQVISETLRLYTVLPVLNRECLEDYEVP-GHPKYVIKKGMPVLIPCGAMHRDEKLYANPN 419
            .:.:|...|.|:|||:..:.|::|.|.:|..:| |.   ||.||:..:|...|.|.:..::.:|.
Mouse   389 QLPFLTMCIKESLRLHPPVTVISRRCTQDIVLPDGR---VIPKGVICIINIFATHHNPTVWPDPE 450

  Fly   420 TFNPDNFSPERVKERDSVEWLPFGDGPRNCIGMRFGQMQARSGLALLINRFKFSVCEQTTIPIVY 484
            .::|..|.||.:|:|..:.::||..|||||||..|...:.:..|||.:.||:  |......|  .
Mouse   451 VYDPFRFDPENIKDRSPLAFIPFSAGPRNCIGQTFAMNEMKVALALTLLRFR--VLPDDKEP--R 511

  Fly   485 SKKTFLISSETGIFLKVE 502
            .|...::.:|.|::|:||
Mouse   512 RKPELILRAEGGLWLRVE 529

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a9NP_523748.2 p450 35..499 CDD:278495 119/468 (25%)
Cyp4f15NP_598888.1 p450 57..526 CDD:278495 119/468 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.