DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a19 and CYP4F2

DIOPT Version :9

Sequence 1:NP_611001.2 Gene:Cyp6a19 / 36662 FlyBaseID:FBgn0033979 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_001073.3 Gene:CYP4F2 / 8529 HGNCID:2645 Length:520 Species:Homo sapiens


Alignment Length:530 Identity:145/530 - (27%)
Similarity:244/530 - (46%) Gaps:69/530 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LLGLVVGVLTLVAWWVLQNYTYW----KRRGIPHDP-PNIPLGNTGELWRT---MPLAGILKRTY 60
            ||.|:||...|:|..:...|.::    :.|..|..| .|...|:.|.:..|   |.:...|..||
Human    20 LLLLLVGASWLLAHVLAWTYAFYDNCRRLRCFPQPPRRNWFWGHQGMVNPTEEGMRVLTQLVATY 84

  Fly    61 LKFRKQTDGPFAGFYLYAMKYIVITDVDFVKTVL-----IRDFDKFHDRGVYHNEKDDPLTNNLA 120
            .:..|...||.:       ..:.:...|.:::|:     |...|||     :::..:..|.:.|.
Human    85 PQGFKVWMGPIS-------PLLSLCHPDIIRSVINASAAIAPKDKF-----FYSFLEPWLGDGLL 137

  Fly   121 TIEGQKWKNLRQKLTHTFTSAKMKSMFSTVLNVGDEMIRVVDEK----ISSSSQTLEVTDIVSRF 181
            ...|.||...|:.||..|..    ::....:.:.:|.:.::..|    .|..|..|::.:.:|..
Human   138 LSAGDKWSRHRRMLTPAFHF----NILKPYMKIFNESVNIMHAKWQLLASEGSACLDMFEHISLM 198

  Fly   182 TSDVIGICAFGLKCNSLRDPKAEFVQ--MGYSALRERRHGWL---VDLLIFGMP-----KLAVKL 236
            |.|.:..|.|....:....| :|::.  :..|||..:||..:   :|.|.:..|     :.|.:|
Human   199 TLDSLQKCVFSFDSHCQEKP-SEYIAAILELSALVSKRHHEILLHIDFLYYLTPDGQRFRRACRL 262

  Fly   237 GFQFLLPSVQKFYMKIVQDTID--YRMKRKVTRNDFMDTLIDMKQQYDKGDKENGLAFNEVAAQA 299
            ...|....:|:....:....:|  .:.|.|....||:|.|:..|   |:..|:  |:..::.|:|
Human   263 VHDFTDAVIQERRRTLPSQGVDDFLQAKAKSKTLDFIDVLLLSK---DEDGKK--LSDEDIRAEA 322

  Fly   300 FVFFLAGFEAGSTTMGFTLYELACNQDVQDKLRAEIDSVL-ERYNGKLEYDSMQDLFYMEKVINE 363
            ..|...|.:..::.:.:.||.||.:.:.|::.|.|:..:| :|...::|:|.:..|.::...:.|
Human   323 DTFMFEGHDTTASGLSWVLYHLAKHPEYQERCRQEVQELLKDREPKEIEWDDLAHLPFLTMCMKE 387

  Fly   364 SLRKHPVVAHLARIATK----PYQHSNPKYFIEAGTGVLVSTLGIHHDPEFYPEPEKFIPERFDE 424
            |||.||.|..::|..|:    |.....||     |...|:|..|.||:|..:|:||.:.|.|||.
Human   388 SLRLHPPVPVISRHVTQDIVLPDGRVIPK-----GIICLISVFGTHHNPAVWPDPEVYDPFRFDP 447

  Fly   425 EQVKKRPTCAFLPFGAGPRNCIGLRF--GRMQVIIGLALLIHNFRFELHPKTPVPMKYTINNLLL 487
            |.:|:|...||:||.||||||||..|  ..|:|::.|.||    ||.:.|....|.:..  .|:|
Human   448 ENIKERSPLAFIPFSAGPRNCIGQTFAMAEMKVVLALTLL----RFRVLPDHTEPRRKP--ELVL 506

  Fly   488 GSEGGIHLNI 497
            .:|||:.|.:
Human   507 RAEGGLWLRV 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a19NP_611001.2 p450 32..495 CDD:278495 135/494 (27%)
CYP4F2NP_001073.3 DUF4175 4..>57 CDD:372724 11/36 (31%)
p450 52..515 CDD:365848 135/495 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.