DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a19 and CYP705A8

DIOPT Version :9

Sequence 1:NP_611001.2 Gene:Cyp6a19 / 36662 FlyBaseID:FBgn0033979 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_180268.1 Gene:CYP705A8 / 817242 AraportID:AT2G27000 Length:514 Species:Arabidopsis thaliana


Alignment Length:516 Identity:99/516 - (19%)
Similarity:219/516 - (42%) Gaps:108/516 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VLTLVAWWVLQNYTYWKRR-----GIPHDPPNIPLGNTGELWRTMPLAGILKRTYLKFRKQTDGP 70
            :|.|:....:..|:::.::     .:|..||::|:  .|.|...:.|  .:.|:..|...:. ||
plant    14 ILILLCLLSILCYSFFFKKPKDGFNLPPSPPSLPI--IGHLHHLLSL--FMHRSLQKLSSKY-GP 73

  Fly    71 FAGFYLYAMKYIVITDVDFVKTVLIRDFDKFHDRGVYHNEKDDPLTNN----------LATIEGQ 125
            ....:::.:..::::.....       ::.|..:.|..:.:|.| ||.          :....|:
plant    74 LLYLHVFNVPILLVSSPSIA-------YEIFRAQDVNVSTRDFP-TNEGSLFLGSFSFITAPYGE 130

  Fly   126 KWKNLRQKL------------THTFTSAKMKSMFSTVLNVGDEMIRVVDEKISSSSQTLEVTDIV 178
            .||.:::.:            :....:.:::..:|.:|   |:.::         .:::|:.|..
plant   131 YWKFMKKLIVTKLLGPQALERSQRIRANEVERFYSNLL---DKAMK---------KESVEIADEA 183

  Fly   179 SRFTSDVIGICAFGLKCNSLRDPKAE----FVQMGYSALRE-------RRHGWLVDLLIFGMPKL 232
            .:..:::|.....|..| |..:.:||    .|....:.|::       |:....:.:.:|....:
plant   184 MKLVNNIICKMIMGRTC-SEENGEAERIRGLVTKSDALLKKFLLAAILRKPLKKIGITLFKKVFM 247

  Fly   233 AVKLGFQFLLPSVQKFYMKIVQDTIDYRMKRKVTRNDFMDTLIDMKQQYDKGDK--ENGLAFNEV 295
            .:.|.|..:|..:      :|::  :.|::......|.||.|:::     .|||  |..:..:.:
plant   248 DISLKFDEVLEKI------LVEN--EERLEENQQGTDIMDKLLEV-----YGDKTSEYKITRDHI 299

  Fly   296 AAQAFVFFLAGFEAGSTTMGFTLYELACNQDVQDKLRAEIDSVLERYNGK---LEYDSMQDLFYM 357
            .:.....|.||.:..:.|:.:|:.|:..|..:.::||.|||||:    ||   ::...:.:|.|:
plant   300 KSLFVDLFFAGTDTATHTIEWTMAEIMNNSLILERLREEIDSVV----GKTRLIQETDLPNLLYL 360

  Fly   358 EKVINESLRKHPVVAHLARIATKPYQ-------HSNPKYFIEAGTGVLVSTLGIHHDPEFYPEPE 415
            :..:.|.||.||.:.    :..:.:|       .|.||     .|.::|:...|..||:.:.:|.
plant   361 QATVKEGLRLHPTIP----LVLRTFQDGCTIGGFSIPK-----KTKLVVNGYAIMRDPDNWEDPL 416

  Fly   416 KFIPERF------DEEQVKKRPTCAFLPFGAGPRNCIGLRFGRMQVIIGLALLIHNFRFEL 470
            :|.||||      .::...|.....:|.||:|.|.|.|:....:.|...:.:::..|.:::
plant   417 EFKPERFLASSRSSQKDAIKEEVLKYLSFGSGRRGCPGVNLAYVSVETAIGVMVQCFDWKI 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a19NP_611001.2 p450 32..495 CDD:278495 96/490 (20%)
CYP705A8NP_180268.1 p450 55..506 CDD:299894 90/473 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D467733at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.