DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a19 and Cyp4d14

DIOPT Version :9

Sequence 1:NP_611001.2 Gene:Cyp6a19 / 36662 FlyBaseID:FBgn0033979 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_001259179.1 Gene:Cyp4d14 / 45706 FlyBaseID:FBgn0023541 Length:510 Species:Drosophila melanogaster


Alignment Length:437 Identity:96/437 - (21%)
Similarity:189/437 - (43%) Gaps:100/437 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 LTNNLATIEGQKWKNLRQKLTHTFTSAKMKSMFSTVLNVGDEMIRVVDEKISSSSQTL----EVT 175
            |.:.|...:|:||...|:.:|..|.           ..:.::.:.|.|::.::..|.|    :..
  Fly   115 LGDGLLISQGKKWFRRRKIITPAFH-----------FKILEDFVEVFDQQSATMVQKLYDRADGK 168

  Fly   176 DIVSRF------TSDVIGICAFGLKCNSLRDPKAEFVQMGYSALRERRHGWLVDLLIFGMPKLAV 234
            .:::.|      ..|:|...|.|:|.|:...|:..:||...:|                    :.
  Fly   169 TVINMFPVACLCAMDIIAETAMGVKINAQLQPQFTYVQSVTTA--------------------SA 213

  Fly   235 KLGFQFLLP------SVQKFYMKIVQDTIDYRMKRKVTRNDFMDTLIDMKQQY------DKGDKE 287
            .|..:|:.|      :::.||.|:: |.::..:|   ..:||.:::|..:::.      |.||.:
  Fly   214 MLAERFMNPLQRLDFTMKLFYPKLL-DKLNDAVK---NMHDFTNSVITERRELLQKAIADGGDAD 274

  Fly   288 NG--------------------------LAFNEVAAQAFVFFLAGFEAGSTTMGFTLYELACNQD 326
            ..                          |:.:::..:...|...|.:..::::.||.|.||.:.:
  Fly   275 AALLNDVGQKRRMALLDVLLKSTIDGAPLSNDDIREEVDTFMFEGHDTTTSSIAFTCYLLARHPE 339

  Fly   327 VQDKLRAEIDSVL-ERYNGKLEYDSMQDLFYMEKVINESLRKHPVVAHLARIATKPYQHSNPKYF 390
            ||.::..|:..|: :..:..:....:.:|.|:|.||.||||..|.|..:.|..::.......  .
  Fly   340 VQARVFQEVRDVIGDDKSAPVTMKLLGELKYLECVIKESLRLFPSVPIIGRYISQDTVLDGK--L 402

  Fly   391 IEAGTGVLVSTLGIHHDPEFYPEPEKFIPERFDEEQVKKRPTCAFLPFGAGPRNCIGLRFGRMQV 455
            |.|.:.|::.......||:::|:||||||:||..|:..:....|:.||.||||||||.:|..:::
  Fly   403 IPADSNVIILIYHAQRDPDYFPDPEKFIPDRFSMERKGEISPFAYTPFSAGPRNCIGQKFAMLEM 467

  Fly   456 IIGLALLIHNFRF-----ELHPKTPVPMKYTINNLLLGSEGGIHLNI 497
            ...::.::.:|..     |:.|         :.|::|.|..||:..:
  Fly   468 KSTISKMVRHFELLPLGEEVQP---------VLNVILRSTTGINCGL 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a19NP_611001.2 p450 32..495 CDD:278495 96/433 (22%)
Cyp4d14NP_001259179.1 p450 34..489 CDD:278495 90/410 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.