DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a19 and Cyp4ad1

DIOPT Version :9

Sequence 1:NP_611001.2 Gene:Cyp6a19 / 36662 FlyBaseID:FBgn0033979 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_610380.1 Gene:Cyp4ad1 / 35821 FlyBaseID:FBgn0033292 Length:516 Species:Drosophila melanogaster


Alignment Length:532 Identity:120/532 - (22%)
Similarity:206/532 - (38%) Gaps:128/532 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 LAGILKRTYLKFRKQTDGPFAG-FYLYAMKYIVITDVDFVKTVL--IRDFDKFHDRGV----YHN 109
            :|||::    .....|..||.| .:.:.:|     ..::.|.||  .|.:|....|.:    ||.
  Fly    28 MAGIME----MIPGPTPYPFVGNLFQFGLK-----PAEYPKKVLQYCRKYDFQGFRSLVFLQYHM 83

  Fly   110 EKDDP-------------------------LTNNLATIEGQKWKNLRQKLTHTFTSAKMKSMFST 149
            ...||                         |.:.|.|..|.:|...::.....|..:.::.....
  Fly    84 MLSDPAEIQNILSSSSLLYKEHLYSFLRPWLGDGLLTSSGARWLKHQKLYAPAFERSAIEGYLRV 148

  Fly   150 VLNVGDEMIRVVDEKISSSSQTLEVTDIVSRFTSDVIGICAFGLKCNSLRDPKAEFVQMGYSALR 214
            |...|.:.::.:| .:|.:.:..:..::|::.|.|::...|.|...:||....::.         
  Fly   149 VHRTGGQFVQKLD-VLSDTQEVFDAQELVAKCTLDIVCENATGQDSSSLNGETSDL--------- 203

  Fly   215 ERRHGWLVDLL------IFGMPKLAVKLGFQFLLPSVQKFYMK----------IVQDTIDYRMKR 263
               ||.:.||.      .|.:.|   :....|.|.|   :|||          .:...|..|..:
  Fly   204 ---HGAIKDLCDVVQERTFSIVK---RFDALFRLTS---YYMKQRRALSLLRSELNRIISQRRHQ 259

  Fly   264 KVTRN----------DFMDTLIDMKQQYDKGDKENGLAFNEVAAQAFVFFLAGFEAGSTTMGFTL 318
            ....|          .|:|.|:..|.. .|..||     .|:..:...|...|.:..:..:.|||
  Fly   260 LAAENTCQQGQPINKPFLDVLLTAKLD-GKVLKE-----REIIEEVSTFIFTGHDPIAAAISFTL 318

  Fly   319 YELACNQDVQDKLRAEIDSVL-ERYNGKLEYDSMQDLFYMEKVINESLRKHPVVAHLARIATKPY 382
            |.|:.:.::|.|...|...:. |.:.|:.:...:..:.|:|.:|.|:||.:|.|..:||....|.
  Fly   319 YTLSRHSEIQQKAAEEQRRIFGENFAGEADLARLDQMHYLELIIRETLRLYPSVPLIARTNRNPI 383

  Fly   383 QHSNPKYFIEAGTGVLVSTLGIHHDPEFYPEPEKFIPERFDEEQVKKRPTC-----AF--LPFGA 440
            ..:..|  :...|.|::..:.:.::.:::.:|..|.||||:      .||.     ||  :||.|
  Fly   384 DINGTK--VAKCTTVIMCLIAMGYNEKYFDDPCTFRPERFE------NPTGNVGIEAFKSVPFSA 440

  Fly   441 GPRNCIGLRFGRMQVIIGLALLIHNFRFELHPKTP--------------VPM-KY--TIN-NLLL 487
            |||.||..:|...|:...|:.|:.  |||:.|...              ||. :|  .:| .:.|
  Fly   441 GPRRCIAEKFAMYQMKALLSQLLR--RFEILPAVDGLPPGINDHSREDCVPQSEYDPVLNIRVTL 503

  Fly   488 GSEGGIHLNITK 499
            .||.||.:.:.|
  Fly   504 KSENGIQIRLRK 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a19NP_611001.2 p450 32..495 CDD:278495 119/526 (23%)
Cyp4ad1NP_610380.1 p450 36..470 CDD:278495 106/473 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.