DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a19 and Cyp4s3

DIOPT Version :9

Sequence 1:NP_611001.2 Gene:Cyp6a19 / 36662 FlyBaseID:FBgn0033979 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_573003.2 Gene:Cyp4s3 / 32444 FlyBaseID:FBgn0030615 Length:495 Species:Drosophila melanogaster


Alignment Length:494 Identity:122/494 - (24%)
Similarity:215/494 - (43%) Gaps:77/494 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 IPLGNTGELWRTMPLAGILKRTYLKFRKQTDGPFAGFYLYAMKYIVITDVDFVKTVL-------- 94
            :|....|||...:....||  .:||..::..||....:......::.||.:.:|.:|        
  Fly    35 LPGPTIGELIANVKKGEIL--NWLKELREKHGPVFRIWFGKDLMVMFTDPEDIKQLLGNNQLLTK 97

  Fly    95 IRDFDKFHDRGVYHNEKDDP-LTNNLATIEGQKWKNLRQKLTHTFTSAKMKSMFSTVLNVGDEMI 158
            .|:::..           :| |...|.|..|:.|...|:.||..| ..::.|.|...:   :|..
  Fly    98 SRNYELL-----------EPWLGKGLLTNGGESWHRRRKLLTPGF-HFRILSEFKEPM---EENC 147

  Fly   159 RVVDEKI--SSSSQTLEVTDIVSRFTSDVIGICAFGLKCNSLRDPKAEFVQMGYSALR---ERRH 218
            |::..::  .::.::.::...::.|..|.|...|.|:|.::.....:|:||...|..|   ::..
  Fly   148 RILVRRLRTKANGESFDIYPYITLFALDAICETAMGIKKHAQLQSDSEYVQAVQSICRVMHKQSF 212

  Fly   219 GWLVDLLIF------GMPKLA------------VKLGFQFLLPSVQKFYMKIVQDTIDYRMKRKV 265
            .:...|.:|      |..:.|            ::|..:.|:....::..:..||  |...||::
  Fly   213 SFWQRLNVFFKHTKPGKEREAALKVLHDETNRVIRLRREQLIQERNEWKPEAEQD--DVGAKRRL 275

  Fly   266 TRNDFMDTLIDMKQQYDKGDKENGLAFNEVAAQAFVFFLAGFEAGSTTMGFTLYELACNQDVQDK 330
            .   |:|.|:..:.:   |..|  |:..::..:...|...|.:..|:.:.|.|..|:.|.|||.:
  Fly   276 A---FLDMLLLTQME---GGAE--LSDTDIREEVDTFMFEGHDTTSSAIAFALSLLSKNPDVQQR 332

  Fly   331 LRAEIDSVLERYNGKLEYDSMQDLFYMEKVINESLRKHPVVAHLARIATKPYQHSNPKYFIEAGT 395
            ...|...:..|     |.:||.   |:|.||.|:||.:|.|...:|...:..:..  |..:..|.
  Fly   333 AFEEASELEGR-----EKESMP---YLEAVIKETLRIYPSVPFFSRKVLEDLEVG--KLTVPKGA 387

  Fly   396 GVLVSTLGIHHDPEFYPEPEKFIPERFDEEQVKKRPTCAFLPFGAGPRNCIGLRFGRMQVIIGLA 460
            .:......:|.||:.:|:||:|.|:||...:.:..| .||..|.||||||||.:|..:::...||
  Fly   388 SISCLIYMLHRDPKNFPDPERFDPDRFLVNEKQMHP-FAFAAFSAGPRNCIGQKFAMLELKTSLA 451

  Fly   461 LLIHNFRFELHPK--TPVPMKYTINNLLLGSEGGIHLNI 497
            :|:.::|| |..|  .|.|:.    .|:..|..||.|.|
  Fly   452 MLLRSYRF-LPDKDHQPKPLA----ELVTKSGNGIRLRI 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a19NP_611001.2 p450 32..495 CDD:278495 120/490 (24%)
Cyp4s3NP_573003.2 p450 35..469 CDD:278495 115/472 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.