DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a19 and Cyp4f39

DIOPT Version :9

Sequence 1:NP_611001.2 Gene:Cyp6a19 / 36662 FlyBaseID:FBgn0033979 Length:503 Species:Drosophila melanogaster
Sequence 2:XP_006241152.1 Gene:Cyp4f39 / 299566 RGDID:1308796 Length:550 Species:Rattus norvegicus


Alignment Length:460 Identity:125/460 - (27%)
Similarity:207/460 - (45%) Gaps:66/460 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 GPFAGFYLYAMKYIVITDVDFVKTVL-----IRDFDKFHDRGVYHNEKDDPLTNNLATIEGQKWK 128
            |||       :..:|:...|::|.||     |...|:|     :::.....|.:.|...:|.||.
  Rat   101 GPF-------LPLLVLVHPDYIKPVLGASAAIAPKDEF-----FYSFLKPWLGDGLLISKGNKWS 153

  Fly   129 NLRQKLTHTFTSAKMKSMFSTVLNVGDEMIRVVDEK-----ISSSSQTLEVTDIVSRFTSDVIGI 188
            ..|:.||..|....:|    ..:.:.::.:.::..|     ...|..:.::.:.||..|.|.:..
  Rat   154 RHRRLLTPAFHFDILK----PYMKIFNQSVNIMHAKWRRHLAEGSVTSFDMFEHVSLMTLDSLQK 214

  Fly   189 CAFGLKCN---SLRDPKAEFVQMGYSALRERRHGWLVDLLIFGMPKLAVKLGFQFLLPSVQKFYM 250
            |.|....:   .|.|..:..:::  |||..||...|...|.|.....|....|:....:|..|..
  Rat   215 CVFSYSSDCQEKLSDYISSIIEL--SALVVRRQYRLHHYLDFIYYLTADGRRFRQACDTVHNFTT 277

  Fly   251 KIVQDTIDYRMKRKVTRN---------------DFMDTLIDMKQQYDKGDKENGLAFNEVAAQAF 300
            :::|      .:|:..|.               ||:|.|:..|   |:..||  |:..::.|:|.
  Rat   278 EVIQ------QRRRALRELGAEAWLKAKQGKTLDFIDVLLLAK---DEEGKE--LSDEDIRAEAD 331

  Fly   301 VFFLAGFEAGSTTMGFTLYELACNQDVQDKLRAEIDSVLE-RYNGKLEYDSMQDLFYMEKVINES 364
            .|...|.:..|:.:.:.|:.||...:.|||.|.||..|:: |...:|::|.:..|.:....|.||
  Rat   332 TFMFEGHDTTSSGLSWALFNLAKYPEYQDKCREEIQEVMKGRELEELDWDDLTQLPFTTMCIKES 396

  Fly   365 LRKHPVVAHLARIATKPYQHSNPKYFIEAGTGVLVSTLGIHHDPEFYPEPEKFIPERFDEEQVKK 429
            ||:.|.|..::|..|:..:..:.: .|..|...|||..|.|::|..:|:.:.:.|.|||.:..::
  Rat   397 LRQFPPVTLISRRCTEDIKLPDGR-IIPKGIICLVSIYGTHYNPLVWPDSKVYNPYRFDPDIPQQ 460

  Fly   430 RPTCAFLPFGAGPRNCIGLRF--GRMQVIIGLALLIHNFRFELHPKTPVPMKYTINNLLLGSEGG 492
            |...||:||.||||||||..|  ..|:|::.|.||  .||..:.....|..|   ..|:|.:|.|
  Rat   461 RSPLAFVPFSAGPRNCIGQSFAMAEMRVVVALTLL--RFRLSVDRTRKVRRK---PELILRTENG 520

  Fly   493 IHLNI 497
            :.||:
  Rat   521 LWLNV 525

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a19NP_611001.2 p450 32..495 CDD:278495 123/456 (27%)
Cyp4f39XP_006241152.1 CYP4F 82..523 CDD:410772 123/456 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.