DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a19 and Cyp4a10

DIOPT Version :9

Sequence 1:NP_611001.2 Gene:Cyp6a19 / 36662 FlyBaseID:FBgn0033979 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_034141.3 Gene:Cyp4a10 / 13117 MGIID:88611 Length:509 Species:Mus musculus


Alignment Length:464 Identity:126/464 - (27%)
Similarity:206/464 - (44%) Gaps:74/464 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 FAGFYLYAMKYIVITDVDFVKTVLIRDFDKFHDRGVYHNEKDDPLTN------------NLATIE 123
            |..::..:..|:.:.|.|::|.:|.|               .||..|            .|..:.
Mouse    85 FPRWFWGSKAYLTVYDPDYMKVILGR---------------SDPKANGAYRLLAPWIGYGLLLLN 134

  Fly   124 GQKWKNLRQKLTHTFTSAKMKSMFSTVLNVGDEMIRVVD--EKISSSSQTLEVTDIVSRFTSDVI 186
            ||.|...|:.||..|....:|..   |.|:.|.:..::|  |:::....::|:...:|..|.|.:
Mouse   135 GQPWFQHRRMLTPAFHYDILKPY---VKNMADSIRLMLDKWERLADQDSSIEIFQHISLMTLDTV 196

  Fly   187 GICAFGLKCNSLRDPK--------AEFVQMGYSALRE--RRHGWLVDLLIFG-MPKLAVKLGFQF 240
            ..|||..|.:...|..        .:...:.:|.:|.  .::..:..|...| :.|.|.:|....
Mouse   197 MKCAFSHKGSVQVDGNYRTYLQAIGDLNNLFHSRVRNIFHQNDTIYKLSSNGRLAKQACQLAHDH 261

  Fly   241 LLPSVQKFYMKIVQDTIDYRMKRKVTRNDFMDTLIDMKQQYDKGDKENG--LAFNEVAAQAFVFF 303
             ...|.|.....:||..:....:|..|.||:|.|:..:.       |||  ::..::.|:...|.
Mouse   262 -TDGVIKLRKDQLQDEGELEKIKKKRRLDFLDILLFARM-------ENGDSMSDKDLRAEVDTFM 318

  Fly   304 LAGFEAGSTTMGFTLYELACNQDVQDKLRAEIDSVLERYNGKLEYDSMQDLFYMEKVINESLRKH 368
            ..|.:..::.:.:..|.||.:.|.|.:.|.|:.|:|.. ...:.:|.:..:.|....|.|:||.:
Mouse   319 FEGHDTTASGVSWIFYALATHPDHQQRCREEVQSLLGD-GSSITWDHLDQIPYTTMCIKEALRLY 382

  Fly   369 P----VVAHLARIATKPYQHSNPKYFIEAGTGVLVSTLGIHHDPEFYPEPEKFIPERFDEEQVKK 429
            |    :|..|:...|.|...|.||     |..|.:|..|:||:|:.:|.||.|.|.||..:  ..
Mouse   383 PPVPGIVRELSTSVTFPDGRSLPK-----GVQVTLSIYGLHHNPKVWPNPEVFDPSRFAPD--SP 440

  Fly   430 RPTCAFLPFGAGPRNCIGLRF--GRMQVIIGLALLIHNFRFELHP-KTPVPMKYTINNLLLGSEG 491
            |.:.:||||..|.|||||.:|  ..::||:.|.||    ||||.| .|.|||  .:..|:|.|:.
Mouse   441 RHSHSFLPFSGGARNCIGKQFAMSELKVIVALTLL----RFELLPDPTRVPM--PLARLVLKSKN 499

  Fly   492 GIHLNITKV 500
            ||:|::.|:
Mouse   500 GIYLHLKKL 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a19NP_611001.2 p450 32..495 CDD:278495 124/457 (27%)
Cyp4a10NP_034141.3 p450 52..503 CDD:278495 124/457 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.