DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a23 and CYP702A1

DIOPT Version :9

Sequence 1:NP_611000.2 Gene:Cyp6a23 / 36661 FlyBaseID:FBgn0033978 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_176744.1 Gene:CYP702A1 / 842878 AraportID:AT1G65670 Length:482 Species:Arabidopsis thaliana


Alignment Length:536 Identity:111/536 - (20%)
Similarity:200/536 - (37%) Gaps:117/536 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LLTLIALLVSLLLFMARRRHGYWQRRG-------IPHDVPHPIYGNMKDWPKKRHIAMIFRDYYT 61
            |||::..|:.:.||     |..:|.:.       .|..:..||.|...:: .|.|.|..|..:..
plant     7 LLTVMVSLIVVKLF-----HWIYQSKNPKPNEKLPPGSMGFPIIGETFEF-MKPHDAFQFPTFIK 65

  Fly    62 KYKRSVYPFAGFYFFFTRSAVITDLELVKRVLIKDFNH-----------FENRGIFYNEIDDPLS 115
            :......|......|..:..:.||:||  .:.|...||           |....:|:.       
plant    66 ERIIRYGPIFRTSLFGAKVIISTDIEL--NMEIAKTNHAPGLTKSIAQLFGENNLFFQ------- 121

  Fly   116 ATLFSIEGQKWRHLRHKLTPTFTSGKMKNMFPIIVKVGEEMEKIFSAKTTTGEGQVLEIVDLVAR 180
                |.|..|  |:|:.......|..:|      :.|.::::.:  .:|...||.....:| |..
plant   122 ----SKESHK--HVRNLTFQLLGSQGLK------LSVMQDIDLL--TRTHMEEGARRGCLD-VKE 171

  Fly   181 YTADVIGNCAFGLNCNSLQNPNAEFVTIGKRAIIERRYGGLLDFLIFGFPKLSRRLRLKLNVQDV 245
            .::.::..|........::...|:.:.:..|.                ||  |...|..||:.  
plant   172 ISSKILIECLAKKVTGDMEPEAAKELALCWRC----------------FP--SGWFRFPLNLP-- 216

  Fly   246 EDFYTSIVRNTIDYRLRTNEKRHDFMDSLIEMYEKEQAGNTEDG------------LSFNEILAQ 298
                     .|..|::....||  .:..|.|...|::|...|.|            :|.:..:..
plant   217 ---------GTGVYKMMKARKR--MLHLLKETILKKRASGEELGEFFKIIFEGAETMSVDNAIEY 270

  Fly   299 AFIFFVAGFETSSTTMGFALYELALDQDIQDQLRAEINNVL---SKHNNEFTYEGIKEMKYLEQV 360
            .:..|:...||:...:...:..::.:..:..:|..|...::   ::.....|:|..|.|.:.:.|
plant   271 IYTLFLLANETTPRILAATIKLISDNPKVMKELHREHEGIVRGKTEKETSITWEEYKSMTFTQMV 335

  Fly   361 VMETLRKYPVLAHLTRMTQTDFSPEDPKYFIAKGTTVVIPALGI-------HYDPEIYPEPEKFK 418
            :.|:||       :|....|.|...|.::.:.   :..|||..|       |::|:.|.:|..|.
plant   336 INESLR-------ITSTAPTVFRIFDHEFQVG---SYKIPAGWIFMGYPNNHFNPKTYDDPLVFN 390

  Fly   419 PERFTDEAIAARPSCTWLPFGEGPRNCIGLRFGLMQACVGLAYLIRGYKFSVSTETQIPMKFVVK 483
            |.|:..:.:.|..|.|::|||.|.|.|:|..|..:|..:.:.:|.|. ::|:...|.|...||  
plant   391 PWRWEGKDLGAIVSRTYIPFGAGSRQCVGAEFAKLQMAIFIHHLSRD-RWSMKIGTTILRNFV-- 452

  Fly   484 SILLSAENGIHLKVEK 499
               |...||..::..|
plant   453 ---LMFPNGCEVQFLK 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a23NP_611000.2 p450 36..495 CDD:278495 101/491 (21%)
CYP702A1NP_176744.1 p450 8..440 CDD:386267 101/503 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.