DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a23 and CYP96A8

DIOPT Version :9

Sequence 1:NP_611000.2 Gene:Cyp6a23 / 36661 FlyBaseID:FBgn0033978 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_175193.1 Gene:CYP96A8 / 841171 AraportID:AT1G47620 Length:520 Species:Arabidopsis thaliana


Alignment Length:472 Identity:95/472 - (20%)
Similarity:190/472 - (40%) Gaps:72/472 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 YPFAGFYFFFTRSAVITDLELVKRVLIKDFNHFENRGIFYNEIDDPLSATLFSIEGQKWRHLRHK 132
            :.|.|.:|.........|...:..::..:|::: .:|..::||.:.....:.:.:.:.||..|:.
plant    75 FQFKGPWFVGMDVLATVDPANIHHIMSSNFSNY-IKGPIFHEIFEAFGDGIINTDAELWRDWRNA 138

  Fly   133 LTPTFTSGKMKNMFPIIVKVGEEMEKIFSAKTT---------------TGEGQVLEIVDLVARYT 182
            ....|...:.:|               |||.||               ..|..|:::.|:..|:.
plant   139 SQLIFNHQRYQN---------------FSASTTKTKVNDGLVPLFNHFANEEIVVDLEDVFQRFM 188

  Fly   183 ADVIGNCAFGLNCNSL--QNPNAEFV--------TIGKRAIIERRYGGLLDFLIFGFPKLSRRLR 237
            .|:......|.:..||  :.|..||.        .|..|.|..|....|..::..|..|  :.|:
plant   189 YDITFIFITGTDPRSLSIEMPEVEFSKALDDVGDAIVHRHITPRFVWKLQKWIGIGTEK--KMLK 251

  Fly   238 LKLNVQDVEDFYTSIVRNTIDYR---LRTNEKRHDFMDSLIEM----YEKEQAGNTEDGLSFNEI 295
            .......|.:...:..|..:..:   ..:|.:|.|.:.|.|::    ||..:.       |.::.
plant   252 AHATFDRVCEKIIAAKREELGSQGITYNSNGEREDLLTSFIKLDATKYEVLKP-------SHDKF 309

  Fly   296 LAQAFI-FFVAGFETSSTTMGFALYELALDQDIQDQLRAEINNVLSKHNNEFTYEG-IKEMKYLE 358
            |....| |..||.:::::|:.:..:.|:.:.::..::..|||..|.:..::..... :.::.||.
plant   310 LRDFTIGFMAAGRDSTASTLTWFFWNLSKNPNVLTKILQEINTNLPRTGSDQDMSSYLNKLVYLH 374

  Fly   359 QVVMETLRKYPVLAHLTRM-TQTDFSPEDPKYFIAKGTTVVIPALGIHYDPEIYPEPE-KFKPER 421
            ..:.|::|.||.:....:. .:.|..|...|  :.....::|....:.....|:.|.. :|||||
plant   375 GALSESMRLYPPIPFQRKSPIKEDVLPSGHK--VKSNINIMIFIYAMGRMKTIWGEDAMEFKPER 437

  Fly   422 FTDEAIAAR--PSCTWLPFGEGPRNCIG--LRFGLMQACVGLAYLIRGYKFSVSTETQIPMKFVV 482
            :..|....|  ||..:|.|..|||.|:|  |...||:..:  ..:::.|:..:.:..:|..|   
plant   438 WISETGGVRHEPSYKFLSFNAGPRTCLGKNLAMNLMKTVI--VEILQNYEIKIVSGQKIEPK--- 497

  Fly   483 KSILLSAENGIHLKVEK 499
            ..::|..::|:.:.:.|
plant   498 PGLILHMKHGLKVTMTK 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a23NP_611000.2 p450 36..495 CDD:278495 94/466 (20%)
CYP96A8NP_175193.1 p450 1..515 CDD:386267 95/472 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.