DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a23 and CYP94D1

DIOPT Version :9

Sequence 1:NP_611000.2 Gene:Cyp6a23 / 36661 FlyBaseID:FBgn0033978 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_174713.1 Gene:CYP94D1 / 840356 AraportID:AT1G34540 Length:498 Species:Arabidopsis thaliana


Alignment Length:443 Identity:99/443 - (22%)
Similarity:199/443 - (44%) Gaps:59/443 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 VKRVLIKDFNHFENRGIFYNEIDDPLSATLFSIEGQKWRHLRHKLTPTFTSGKMKN--MFPIIVK 151
            |:.:|...|..|.....|.:.::|.|...:|:.:|..|...|...:..|::..:::  |..:.|:
plant    85 VEYMLKTKFESFPKGQQFTSVLEDFLGHGIFNSDGDMWWKQRKTASYEFSTKSLRDFVMSNVTVE 149

  Fly   152 VGEEMEKIFSAKTTTGEGQVLEIVDLVARYTADVIGNCAFGLNCNSLQNPNAEFVTIGK-----R 211
            :...:..:.....||  |:::::.|::.|:..|.|...||.::|..|.:..|..|...:     .
plant   150 INTRLVPVLVEAATT--GKLIDLQDILERFAFDNICKLAFNVDCACLGHDGAVGVNFMRAFETAA 212

  Fly   212 AIIERRYGGLLDFLIFGFPKLSRRLRLKLN----------VQDVEDFYTSIVRNTIDYRLRTNEK 266
            .||.:|:..:        ...:.|::.|||          :..|..|...||||.|| :.|:::.
plant   213 TIISQRFRSV--------ASCAWRIKKKLNIGSERVLRESIATVHKFADEIVRNRID-QGRSSDH 268

  Fly   267 RHDFMDSLIEMYEKEQAGNTEDGLSFNEILAQAFI-FFVAGFETSSTTMGFALYELALDQDIQDQ 330
            :.|.:...|   .||:       ::..|||....| |.:||.:|:|:.:.:..:.|::..:::|:
plant   269 KEDLLSRFI---SKEE-------MNSPEILRDIVISFILAGRDTTSSALSWFFWLLSMHPEVEDK 323

  Fly   331 LRAEINNVLSKHNNE----FTYEGIKEMKYLEQVVMETLRKY-PVLAHLTRMTQTDFSPEDPKYF 390
            :..|:|::.::....    :.:|.:|.|.||...:.|:||.| ||...:....:.:..|:..  |
plant   324 ILQELNSIRARTGKRIGEVYGFEHLKMMNYLHAAITESLRLYPPVPVDIKSCAEDNVLPDGT--F 386

  Fly   391 IAKGTTVVIPALGIHYDPEIY-PEPEKFKPERFTDE---AIAARPSCTWLPFGEGPRNCIGLRFG 451
            :.||..:......:.....|: .:.::|.|||:.||   .........:..|..|||.|:|....
plant   387 VGKGWAITYNIFAMGRMESIWGKDCDRFDPERWIDETNGCFRGEDPSKFPAFHAGPRMCVGKDMA 451

  Fly   452 LMQACVGLAYLIRGYKFSVSTETQIPMK---FVVKSILLSAENGIHLKVEKLS 501
            .:|....:|.::.  :|.|    ::|.|   .::.|:.|..:.|:..:|::.|
plant   452 YIQMKSIVAAVLE--RFVV----EVPGKERPEILLSMTLRIKGGLFARVQERS 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a23NP_611000.2 p450 36..495 CDD:278495 97/435 (22%)
CYP94D1NP_174713.1 CYP86A 64..490 CDD:410687 96/433 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.