DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a23 and CYP72C1

DIOPT Version :9

Sequence 1:NP_611000.2 Gene:Cyp6a23 / 36661 FlyBaseID:FBgn0033978 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_001319024.1 Gene:CYP72C1 / 838276 AraportID:AT1G17060 Length:313 Species:Arabidopsis thaliana


Alignment Length:279 Identity:57/279 - (20%)
Similarity:101/279 - (36%) Gaps:80/279 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LLLTLIALLVSLLLFMARRRHGYWQRRG---------------------IPHDVPHPIYGNM--K 44
            |:|..:...|:.:....:|...|.:::|                     :.|.:|.|:..:.  :
plant    18 LILNWVWRAVNWVWLRPKRLEKYLKKQGFSGNSYRILMGDMRESNQMDQVAHSLPLPLDADFLPR 82

  Fly    45 DWPKKRHIAMIFRDYYTKYKRSVYPFAGFYFFFTRSAVITDLELVKRVLIK----------DFNH 99
            ..|...|..:       |:.:..:.:.|.|    .:.::.|.|.::.::.|          ..||
plant    83 MMPFLHHTVL-------KHGKKCFTWYGPY----PNVIVMDPETLREIMSKHELFPKPKIGSHNH 136

  Fly   100 FENRGIFYNEIDDPLSATLFSIEGQKWRHLRHKLTPTFTSGKMKNMFPII----VKVGEEMEKIF 160
                 :|       ||. |.:.||.||...|..|.|.|....:|::.|..    .::.||.|::.
plant   137 -----VF-------LSG-LLNHEGPKWSKHRSILNPAFRIDNLKSILPAFNSSCKEMLEEWERLA 188

  Fly   161 SAKTTTGEGQVLEIVDLVARYTADVIGNCAF------GLNCNSLQNPNAEFVTIGKRAIIERRYG 219
            |||.|..........||    |.:::...:|      |:....:|....:...:..||:    |.
plant   189 SAKGTMELDSWTHCHDL----TRNMLARASFGDSYKDGIKIFEIQQEQIDLGLLAIRAV----YI 245

  Fly   220 GLLDFLIFGFP-KLSRRLR 237
            ....||    | |.:||||
plant   246 PGSKFL----PTKFNRRLR 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a23NP_611000.2 p450 36..495 CDD:278495 50/225 (22%)
CYP72C1NP_001319024.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3438
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.